Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G17190-AT5G47770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):farnesyl diphosphate synthase 2
Function (paralog2):farnesyl diphosphate synthase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.96827692243116
Log2 mRNA fold difference:1.4217273278625
Log2 TE fold difference:-0.3870897092391
Sequences
Protein sequence

MADLKSTFLDVYSVLKSDLLQDPSFEFTHESRQWLERMLDYNVRGGKLNRGLSVVDSYKL
LKQGQDLTEKETFLSCALGWCIEWLQAYFLVLDDIMDNSVTRRGQPCWFRKPKVGMIAIN
DGILLRNHIHRILKKHFREMPYYVDLVDLFNEVEFQTACGQMIDLITTFDGEKDLSKYSL
QIHRRIVEYKTAYYSFYLPVACALLMAGENLENHTDVKTVLVDMGIYFQVQDDYLDCFAD
PETLGKIGTDIEDFKCSWLVVKALERCSEEQTKILYENYGKAEPSNVAKVKALYKELDLE
GAFMEYEKESYEKLTKLIEAHQSKAIQAVLKSFLAKIYKRQK

MSVSCCCRNLGKTIKKAIPSHHLHLRSLGGSLYRRRIQSSSMETDLKSTFLNVYSVLKSD
LLHDPSFEFTNESRLWVDRMLDYNVRGGKLNRGLSVVDSFKLLKQGNDLTEQEVFLSCAL
GWCIEWLQAYFLVLDDIMDNSVTRRGQPCWFRVPQVGMVAINDGILLRNHIHRILKKHFR
DKPYYVDLVDLFNEVELQTACGQMIDLITTFEGEKDLAKYSLSIHRRIVQYKTAYYSFYL
PVACALLMAGENLENHIDVKNVLVDMGIYFQVQDDYLDCFADPETLGKIGTDIEDFKCSW
LVVKALERCSEEQTKILYENYGKPDPSNVAKVKDLYKELDLEGVFMEYESKSYEKLTGAI
EGHQSKAIQAVLKSFLAKIYKRQK

www.000webhost.com

Other information
Ka divergence:-0.226783KaKs divergence:0.0126582
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1029Length 2 (bp):1155Length divergence:0.058
MFE 1 (kcal):-309.04MFE 2 (kcal):-332.3MFE divergence0.036