Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G17245-AT5G47610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.95682519883835
Log2 mRNA fold difference:1.0548917140962
Log2 TE fold difference:-1.8265675886719
Sequences
Protein sequence

MRLLLSSDPQPELTSTCTSHSCGWKPYSHSNDFAANAFLLLIILFCSFICVLSLHAAIRC
CLRPVLQHVPKPDPDLEATHPDAPPTLVYSPGLNLAGNEAECIICLSEFQDGDTLRVLER
CKHGFHVYCIQKWLSSSHSSCPTCRTNIFSSPPQLHSQSLPLTSTP

MRLLVAEAASPLSSAATPTCNSHTCRWKPYSNSTDFTANASVLLILVISALICALSLYAA
IRCFLRPTLETEDDHKPDPEAAASSTPTTPTLVYSSDLELAGAEAECAICLSEFEQGESI
QVLEKCQHGFHVKCIHKWLSTRSSCPTCRTSIFSQHSETPSSHINA

www.000webhost.com

Other information
Ka divergence:0.00529377KaKs divergence:0.99983
GC content 1 (%):51GC content 2 (%):47GC content divergence:-0.041
Length 1 (bp):501Length 2 (bp):501Length divergence:0
MFE 1 (kcal):-106.91MFE 2 (kcal):-115.93MFE divergence0.04