Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G17250-AT5G47580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.57980970713521
Log2 mRNA fold difference:0.089020011647732
Log2 TE fold difference:-0.67449118610504
Sequences
Protein sequence

MGCDSHGNLSDTEFSKPLPSIGVYVAAASLICGVAMFSDLLHGFRHRKFWFPCKFFSLNA
TTLTFISVCVKLSLDLNTSMPSRQDQLAKLSSSVFVCTVMANSMPSLGYMVTQDLLMNLT
ALGILVITDVVNICIQLGTGAIYVFPQEHALVIILMLLMFMILSFSAITVPATKRFLELK
YKKRYEFALKQCPSYTERRRGVPKLKEDLMKFWMMAHTSSPQFVMARSVTCTTTGFLCFL
IAITLAEAMVRSYFLQPRSLGFCNGDSDYKWSTTLVLVSQTAAVAIGTVAPASRWLKAVN
FRCPFRNKKSLKDELRVESYWVECLAEKKERPLNFWMLHGRCSRKLAHDLNRLMLDICIA
TQYGIVLASKFLRFITVYCSSRILLCCFHFTFKSDSVANAESSGSNPSTRQFVLHLEGEE
EMVDYMARSNRVATDHLIQKGRKKQPVNLIELLEATTFISKGFEGIRDFDSDEVSSLASG
EPPNSWALPLVTLTSIAVALPNIKPCSLKKLVKAVNEALVYVNKFEEVLDIEGELANSRK
AAEVVWLGVDLYHKWLNVDLRKLSKQHSKTPQEVLKELVDIAQKEFTESWEKNRILCMKH
KPSHWPIKTQAANSMYRISQTLLMKYESRNIETEETLLKDVEKMVSDIVSGCFCNTAQVI
GMKCLVTAVEVREASVREAAMHLGRTEKILEIVDRRCMPALSHHKVAKIDEWREFYRTNK
SITFTHPSSQCTTRELIINLE

MGILGCDAHGDLNDAEFSKPLPSIGIYVAVASLICGLAMAADLIHGFRHRKFWFPCKFFS
LNATSLTFIAVGIKLSVDLNTSMPSRQDQLAKLSSTVFVCTVMGNSMPSLGIMDNNDLLM
NLMALGILVITDVVNICIQLGTGAIYVFSEEHFLVVLLMLLMLMILCFSATTVPTTKRIL
ESKYNKRYDVAMKCPLATERTVAKKIQQDLSKFWMMAHTSSPQFVMARSVTCTASGFFCL
LSAITLGEAMVRSYFLRPRSLGFCHGDSDYKWSTSLVLVCQTTTVAIGTIAPAIRWFTAV
NFRCPIRGKKYYRDEFRIESYWTHWFSEKKQHPLSLWILKERRYRKTAHNAKRWILDVCI
VIQYVIVFGSKIIRYISVSCVGKILLCCHFALRTSNTITHSESEKSDSNPSSRQDLASFV
LHLEGEDPLVDVMVRSNREATDHWIEKGRKKQPVNLIELLEATTPISKGFEGIAEFDSNK
VASLAHGEPPNCWALPLVTLTSIAVALPDIKPSSLKKLLNAVNEALEYVNKFECVLDTGG
ESVNLRKAAEVVWLGVDLYHKWFDVDLRKLSKQQRNPEETLRELMEIAKKEFSESWQMNL
MVCMKHKPSHWPIKTLAANSMYRICQTILLTYESRDYGTGEALLRKLESTISDIVSGCFC
NVAQVISVKCLVSAVEVREESVRGAALHLGRTEKILEILERRRLPKLRCDQMKNIDEWRA
FYKINSCECDNNNKTVYPDSDELRLTVE

Other information
Ka divergence:-0.141354KaKs divergence:-0.0138331
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2226Length 2 (bp):2247Length divergence:0.005
MFE 1 (kcal):-689.1MFE 2 (kcal):-703.72MFE divergence0.01