Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G17340-AT5G47450
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):tonoplast intrinsic protein 2;2
Function (paralog2):tonoplast intrinsic protein 2;3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.0403276566981
Log2 mRNA fold difference:-2.4914354602835
Log2 TE fold difference:0.44907818799059
Sequences
Protein sequence

MVKIEIGSVGDSFSVASLKAYLSEFIATLLFVFAGVGSALAFAKLTSDAALDPAGLVAVA
VAHAFALFVGVSIAANISGGHLNPAVTLGLAVGGNITVITGFFYWIAQCLGSIVACLLLV
FVTNGESVPTHGVAAGLGAIEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFI
VGANILAAGPFSGGSMNPARSFGPAVVSGDFSQIWIYWVGPLVGGALAGLIYGDVFIGSY
APAPTTESYP

MVKIEVGSVGDSFSVSSLKAYLSEFIATLLFVFAGVGSAVAFAKLTSDGALDPAGLVAIA
IAHAFALFVGVSIAANISGGHLNPAVTLGLAIGGNITLITGFFYWIAQCLGSIVACLLLV
FVTNGKSVPTHGVSAGLGAVEGVVMEIVVTFALVYTVYATAADPKKGSLGTIAPIAIGFI
VGANILAAGPFSGGSMNPARSFGPAVVSGDLSQIWIYWVGPLVGGALAGLIYGDVFIGSY
EAVETREIRV

www.000webhost.com

Other information
Ka divergence:0.17842KaKs divergence:-0.997572
GC content 1 (%):53GC content 2 (%):51GC content divergence:-0.019
Length 1 (bp):753Length 2 (bp):753Length divergence:0
MFE 1 (kcal):-272.61MFE 2 (kcal):-268.75MFE divergence-0.007