Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G17670-AT5G47060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF581)
Function (paralog2):Protein of unknown function (DUF581)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.6568182195951
Log2 mRNA fold difference:1.4598164978925
Log2 TE fold difference:0.087459865691911
Sequences
Protein sequence

MEVSMRKPYFIEEEDDGFVSLSEMEAGVSSPSCYNYPQSYYYNHHHHQYSVSSPRSGKFH
DFRFDNSYYGYGQPHFLDSCFLCKKRLGDNRDIFMYRGDTPFCSEECREEQIERDEAKEK
KQSLSTSVKAMRRNEKRSSSSSPTRSRNYAFRTGTVAAA

MELSSRKPYFIEEEEEENLASSLSEMEAGFSGNNNNSNNHGNPQNGVVSSSRFSYGRLNS
LRNSQSYYYNQYSVSSPRSVVSGRFHDFRFDIQQPHFLDSCFLCKKPLGDNRDIYMYRGD
TPFCSEECRQEQIERDEAKEKKQNLSHSVKSAMRRKEQSSPTRSRDYAFHNGTVAAA

www.000webhost.com

Other information
Ka divergence:0.0817789KaKs divergence:-0.227451
GC content 1 (%):39GC content 2 (%):38GC content divergence:-0.013
Length 1 (bp):480Length 2 (bp):534Length divergence:0.053
MFE 1 (kcal):-135.86MFE 2 (kcal):-149.79MFE divergence0.049