Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G18640-AT5G45840
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Leucine-rich repeat protein kinase family protein
Function (paralog2):Leucine-rich repeat protein kinase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.1327440132609
Log2 mRNA fold difference:-1.9951493225972
Log2 TE fold difference:-0.1487688063143
Sequences
Protein sequence

MMGCGFHFPWFFFLIIGLQAPLSLSLTSQGSALLKFRARVNSDPHGTLANWNVSGINDLC
YWSGVTCVDGKVQILDLSGYSLEGTLAPELSQLSDLRSLILSRNHFSGGIPKEYGSFENL
EVLDLRENDLSGQIPPELSNGLSLKHLLLSGNKFSDDMRIKIVRLQSSYEVRLKKSPKLS
PLAVLGCINRKLGHCVSRNRIIQVKKVEAIVFRIKATSRRFLKAFPSFLEETDIYKRREL
LEETSNLAAEPAPSAPSPSPGIITEASPRSSGSFPAVTNAKKRRPPLVPPVPSPDKGSTS
PDISKNQPQDNKQSKGSKHVWLYVVIAVASFVGLLIIVAVIFFCRKRAVKSIGPWKTGLS
GQLQKAFVTGVPKLNRSELETACEDFSNIIETFDGYTVYKGTLSSGVEIAVASTAIAESK
EWTRAMEMAYRRKIDTLSRINHKNFVNLIGYCEEDDPFNRMMVFEYAPNGTLFEHLHDKE
TEHLDWSARMRIIMGTAYCLQHMHGMNPPMAHTDFNSSEIYLTDDYAAKVSEIPFNLEAR
LNPKKHVSGDLEQTSLLLPPEPEANVHSFGVLMLEIISGKLSFSDEYGSIEQWASKYLEK
DDLGEMIDPSLKTFKEEELEVICDVIRECLKTEQRQRPSMKDVAEQLKQVINITPEKATP
RSSPLWWAELEILSSEAT

MGCRWNPIGFQFSCFMFLIITLQSRSSLSLESEGFVLLKFRARVDSDPHGTLANWNVSDH
DHFCSWFGVTCVDNKVQMLNLSGCSLGGTLAPELSQLSELRSLILSKNKLSGDIPNEFAS
FAKLEFLDLRDNNLNGVVPPELNKVLTPENLLLSGNKFAGFMTVKFLRLQSLYKVQMNKN
RELSSVSADVLDCVNRKLGYCVSRRSLITRNKAKAFVLRIRATSRHYMKAFSFISQYFWV
RRESHGKNYVVNYHPSENETSIFKRRELLEETSNLAAMPAPDTPSPSPEIITIVFPRSSG
SFPALTNAKKRIPPLIPPSSPPPLPTNNTIASDPPRKFEEKSKGFKDVWLYVVIGVAAFV
AMLIIVAVIFFFRKRAVKSIGPWKTGLSGQLQKAFVTGVPKLNRSELETACEDFSNIIEA
FDGYTVYKGTLSSGVEIAVASTAILETREWTRAMEMTYRRRIDTMSRVNHKNFINLIGYC
EEDEPFNRMMVFEYAPNGTLFEHLHDKEMEHLDWNARTRIIMGTAYCLQYMHELNPPISH
TKLVSSAIYLTDDYAAKVGEVPFSGQTGSKPRKPMSGDLDQSLLPLPPEPETNVYSFGVL
MLEIISGKLSDSEEEGSILKWASKYLENDNLRDMIDPTLTTYKEEELEAICDVARHCLKL
DESQRPKMKYVVQQLKEVINISQEQATPRLSPLWWAELEILSSEAT

www.000webhost.com

Other information
Ka divergence:0.0610996KaKs divergence:0.461496
GC content 1 (%):43GC content 2 (%):40GC content divergence:-0.036
Length 1 (bp):2037Length 2 (bp):2121Length divergence:0.02
MFE 1 (kcal):-623.67MFE 2 (kcal):-613.33MFE divergence-0.008