Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G18820-AT5G45720
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AAA-type ATPase family protein
Function (paralog2):AAA-type ATPase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.89807816574471
Log2 mRNA fold difference:-0.8648773561221
Log2 TE fold difference:-0.014441930766087
Sequences
Protein sequence

MTTTTTTTTRVASSSSTRNNRILKDANGDIGEHLRNHIHLTNCIHLKNNMHKQSPVLTDR
ALMRDLIVLQRSRSLRDPSASPPAWNTPPSVVDLLPKKGDLVEGGRRSVDLKKSSRRLSA
LSGSSPVVNFGTSKVTPSDERSGPVSGERDSGRRVKREESSRKSYRIGDDYQNVNEVVSH
GSGSKASRRLSRVNDAMVKTLSDQLNEVVVGDSDDVVSSNVRPRVRYGGGGGGGNTRGCA
GGMSRPKRRKFRGTRRVRGKSRDTGGGKSEMSVASNTLPQVEKHDGEKEGFGEQNMTKAC
GIPFNWSRIHHRGKTFLDKAGRSLSCGMSDSKGGRKGETNERNGSDKMMIQSDDDSSSFI
GSDGEALPLLVDSGENDGWVHDYSGELGIFADSLLKNDEDSDLASEGRSGEKKHKKKSHV
NARHRHRQQHQSLTEKYTPKTFRDLLGQNLVVQALSNAVARRKLGLLYVFHGPNGTGKTS
CARIFARALNCHSMEQPKPCGTCSSCVSHDMGKSWNIREVGPVGNYDFEKIMDLLDGNVM
VSSQSPRVFIFDDCDTLSSDCWNALSKVVDRAAPRHVVFILVCSSLDVLPHVIISRCQKF
FFPKLKDADIVYSLQWIASKEEIEIDKDALKLIASRSDGSLRDAEMTLEQLSLLGQRISV
PLVQELVGLVSDEKLVDLLDLALSADTVNTVKNLRTIMETSVEPLALMSQLATVITDILA
GSYDFTKDQHKRKFFRRQPLPKEDMEKLRQALKTLSEAEKQLRVSNDKLTWLTAALLQLA
PDQNYLLQRSSTADTGGRESSDHHLDPSSDAAGGRSSGLDRRRGDSRKNRPAVEEIWLEV
IEKLRVNGLREFLYKEGRIVSLNLGSAPTVHLMFSSPLTKSTAEKFRSHIMQAFEAVLES
PVTIEIRCETKKDPRNNVHHHHHHPTVKDKSLPQSLALIGHDYNIDGSGRSEIVEVTESN
GQRRQQQKQQEEERTEPVGSSALARARRKHLEASQSQNQSQSIVRGKVSLAHVIQQADGC
SLQNGWSKRKAVSIAEKLEQENLRLEPRSRSLLCWKSSRGTRRKATRLKVRTRRARPHTL
LKLVSCGKCLSTRSPTR

MSRVASSRVLKDSNGDIGEHLRNHIHLTNCIHLKNHMHNNNKQSPVLTDRSLLMRDLVVL
QRSRSLRDPSASPNLKEDHQDSREGRRRSGLRLSGSSPIVSFGTSKVTPSDEKFDRSSRK
SYRVEEVNEVYSVPSVKSVSKDRINKKVNEAIVKTLSDQLNEVGGDSDDLVSCNVRPRGD
GCRRRKFRGTRRAGRAVNVRDNAAGNESEMSIASNSVPRGEKYEGEEGGGGRDREQNMSC
GIPFNWSRIHHRGKTFLDIAGRSLSCGISDSKGRKGEAGTPMFSDSSSSDREALPLLVDS
ADNEEWVHDYSGELGIFADNLLKNGKDSVIGKKSSRKNTRWHQSFTQKYAPRTFRDLLGQ
NLVVQALSNAIAKRRVGLLYVFHGPNGTGKTSCARVFARALNCHSTEQSKPCGVCSSCVS
YDDGKNRYIREMGPVKSFDFENLLDKTNIRQQQKQQLVLIFDDCDTMSTDCWNTLSKIVD
RAPRRVVFVLVCSSLDVLPHIIVSRCQKFFFPKLKDVDIIDSLQLIASKEEIDIDKDALK
LVASRSDGSLRDAEMTLEQLSLLGTRISVPLVQEMVGLISDEKLVDLLDLALSADTVNTV
KNLRIIMETGLEPLALMSQLATVITDILAGSYDFTKDQCKRKFFRRQPLSKEDMEKLKQA
LKTLSESEKQLRVSNDKLTWLTAALLQLAPDKQYLLPHSSSADASFNHTPLTDSDPSNHV
VAGTRRDDSKQGFSCKNRPSVEDIWLAVIENVRVNGLREFLYKEGKIFSISIGSAPMVQL
MFNSPIAKSTAENFEEHILKAFEAVLGSPVTLEMRTESKKDLGFSSLQGLSNGERFRESG
RSEIVEVADSESPMTRVRRKHLEASQNQNQNQNQSIVRGKVSLAQVIKQAEGNSWSKHKA
VEIANKLEQENLKLEPRSRSLICWKASRSTRRKLSRLKVRTRKLRLHSLLKLVSCGKCLS
TRSPPR

www.000webhost.com

Other information
Ka divergence:0.264944KaKs divergence:0.0364915
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):3294Length 2 (bp):2901Length divergence:-0.063
MFE 1 (kcal):-996.02MFE 2 (kcal):-852.44MFE divergence-0.078