Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G19700-AT5G45100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SBP (S-ribonuclease binding protein) family protein
Function (paralog2):SBP (S-ribonuclease binding protein) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.0587262798652
Log2 mRNA fold difference:1.6565933057129
Log2 TE fold difference:0.43521066229677
Sequences
Protein sequence

MAVQAHHMNIFSQFISPNRDCVKFQENMNHGEFEFTGGEVPLITGESFAVEPLAAKANFN
KAESGLSYNFTVPPLSTKRQRDFQFSDSNAPVKRRSVAFDSSSPSLINVELVSQIQNQQQ
SEIDRFVAQQTEKLRIEIEARQQTQTRMLASAVQNVIAKKLKEKDDEIVRIRNLNWVLQE
RVKSLYVENQIWRDIAQTNEANANTLRTNLDQVLAQLETFPTASAVVEDDAESSCGSCCG
DGGGEAVTAVGGGCKRCGEREASVLVLPCRHLCLCTVCGGSALLRTCPVCDMVMNASVHV
NMSS

MAVEARHMNLFSSQYITNRECVKSQTNMNNGQQIAGGGFPVTIGDRNLQYIDPINSFNKS
ESELTAISKRQRDSTFDSDALIASQKRRAIAFSPASLIDAELVSQIQQQNSEIDRFVAQQ
TETLRIELEARQRTQTRMLASAVQNAILKKLKAKDEEIIRMGKLNWVLQERVKNLYVENQ
IWRDLAQTNEATANNLRSNLEQVLAQVDDLDAFRRPLVEEADDAESSCGSCDGGDVTAVV
NGGCKRCGELTASVLVLPCRHLCLCTVCGSSALLRTCPVCDMVMTASVHVNMSS

www.000webhost.com

Other information
Ka divergence:-0.124448KaKs divergence:0.306406
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):915Length 2 (bp):885Length divergence:-0.017
MFE 1 (kcal):-279.5MFE 2 (kcal):-252.5MFE divergence-0.051