Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G20010-AT5G44785
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plastid transcriptionally active 9
Function (paralog2):organellar single-stranded DNA binding protein 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.24693522117625
Log2 mRNA fold difference:-0.061744652089728
Log2 TE fold difference:0.30738401757663
Sequences
Protein sequence

MSLISKSLARIECSPFFYPRASEITTGKRITSPQIRLYTAAAVGGKTGNGERKQRAKAPA
KTPEAVTPVKPLEIASVTATTENELPRPNEIAYESEVANWVNLIGFVDQPVQFEASSDGK
FWAGTVISQRSASDSSGFWIPIIFEGDLAKTAARYVSKDDQIHVSGKLFIDSPPPNMTYA
QANVQVLVQNLNFIQPMSPSPSPFMVMSSSEKEESGIKKQPARAKQDIVIDEASDSWNHL
IENPKEWWDHRENKVNGLVKPRHPDFKSKDSSFSLWLNKAPNWVLPKLEGLEFDVLVPKA
RVVKQLKGEESWKDLVQNPDKWWDNRIDKRNAKAPDFKHKETGEALWLNESPTWVLPKLP
PVKKKQESIVF

MNLISRTLTRAVSSSLYHSKAAKLPTQKWIISQQIRVFSATVISGGGKKPLAKVSVKPPL
NVATEKESTPPKKIEYKPEISNWINLIGFVEQPVQFGPCSDGKFWAGTVISQRSGSKSSN
FWIPIIFEGDLAKIAVQHVKKEDRIHVSGKLFIDSPPPNVTYSQSNVQVMVQNLNFVQAA
TSTTKTISPPEKEVTSIKKKPARSKKVKVIDEETSNSWKHLIENPKEWLDHRGNKANGLV
KPGHPDFKMKVGGLSLWLSTAPDWALLKLEELKFDVLVPKGNIKLNQLKDIGEESWKDLV
QNPDKWLDNRSDKTNVKYPDFKHKETGEALWMTNSPIWVLSKLPPLKKNQERPFMSNKVS
QLELDVEVPKGNLKQLKREEIWKNLVENPSKWWDNRLDKRNPKGPDFKHKETGEALWIGD
SPTWALSKLPPLKKNQERPVMA

www.000webhost.com

Other information
Ka divergence:0.270447KaKs divergence:0.158544
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1116Length 2 (bp):1329Length divergence:0.087
MFE 1 (kcal):-322.77MFE 2 (kcal):-345.92MFE divergence0.035