Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G22080-AT4G22090
Species:Arabidopsis
Duplication type:TD
Function (paralog1):root hair specific 14
Function (paralog2):Pectin lyase-like superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.4604864188397
Log2 mRNA fold difference:-3.4093176371025
Log2 TE fold difference:0.0019714401947601
Sequences
Protein sequence

MTLFTVSCLLVVLFLCHSLVHAENNGYYGYTPTVANYLPEKPQNIMNPVDSCWRLKSDWA
ANRKDLADCVVGFGSSTLGGKKGNLYVVTNPYDNAQNPQPGSLRYGVIQAKPLWITFAKD
MVITLENELMVNSYKTIDGRGAKVEIAYGPCITIQDVTNVIVHGISIHDCKPGKYGMVRS
SPTHVGHRKGSDGDAIAIFGSSNIWIDHCYLASCTDGLIDVIHASTGITISNNYFTQHDK
VMLLGHNDDFVQDVKMKVTVAFNHFGPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSA
DPTIFSEGNYFIASDKSNSKEVTKREVKGGWNNWRWRTSKDVFKNGAYFVPSGYGSISLP
YSSAQRFTVAPGNLVPSLTADAGPLNCNRNGPCY

MTHFTVSCLLVALFLCQSLVHAAYNGYYGYSPAAAPYPAEEPQNIMNPVDSCWRLKSDWD
VNREDLADCAVGFGSSTLGGKKGNIYVVTNPYDNAQNPHPGSLRYGVIQAKPLWITFAKD
MVITLANELMVNSYKTIDGRGAKVEIAYGPCITIQDVTNVIVHGISIHDCKPGKSGKVRS
SPTHVGHRKGSDGDAITIFGSSNVWIDHCYLASCTDGLIDVIHASTAITISNNYFTQHDK
VMLLGHNDNFVKDVKMKVTVAFNHFGPGLVERMPRVRRGYAHVANNRYDKWIMYAIGGSA
DPTIFSEGNYFIASDKSYSKEVTKREVKGGWNNWRWRTSNDVFKNGAFFVPSGYGSIPLP
YSSAQRFTVAPGNLVPSLTADAGPLNCNRNGPCY

www.000webhost.com

Other information
Ka divergence:0.100511KaKs divergence:-0.9998
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1185Length 2 (bp):1185Length divergence:0
MFE 1 (kcal):-356.71MFE 2 (kcal):-366MFE divergence0.013