Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G24280-AT5G49910
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):chloroplast heat shock protein 70-1
Function (paralog2):chloroplast heat shock protein 70-2

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.20148354606502
Log2 mRNA fold difference:0.0044215175143692
Log2 TE fold difference:-0.20766182475415
Sequences
Protein sequence

MASSAAQIHVLGGIGFASSSSSKRNLNGKGGTFMPRSAFFGTRTGPFSTPTSAFLRMGTR
NGGGASRYAVGPVRVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTK
SGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMNEVDEESKQVSYRVVRDENNNVKLECP
AINKQFAAEEISAQVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLE
VLRIINEPTAASLAYGFDRKANETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGG
DDFDKRVVDWLAAEFKKDEGIDLLKDKQALQRLTEAAEKAKIELSSLTQTNMSLPFITAT
ADGPKHIETTLTRAKFEELCSDLLDRVRTPVENSLRDAKLSFKDIDEVILVGGSTRIPAV
QELVRKVTGKEPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMT
KIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGV
PQIEVKFDIDANGILSVSAVDKGTGKKQDITITGASTLPKDEVDQMVQEAERFAKDDKEK
RDAIDTKNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKIGSGSTQEIKDAMA
ALNQEVMQIGQSLYNQPGAGGPGAGPSPGGEGASSGDSSSSKGGDGDDVIDADFTDSQ

MASSAAQIHILGGIGFPTSSSSSSTKNLDNKTNSIPRSVFFGNRTSPFTTPTSAFLRMGR
RNNNASRYTVGPVRVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTK
SKDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMNEVAEESKQVSYRVIKDENGNVKLDCP
AIGKQFAAEEISAQVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLE
VLRIINEPTAASLAYGFERKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGG
DDFDKRVVDWLASTFKKDEGIDLLKDKQALQRLTEAAEKAKIELSSLTQTNMSLPFITAT
ADGPKHIETTLTRGKFEELCSDLLDRVRTPVENSLRDAKLSFKDIDEVILVGGSTRIPAV
QDLVRKLTGKEPNVSVNPDEVVALGAAVQAGVLSGDVSDIVLLDVTPLSLGLETLGGVMT
KIIPRNTTLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSIGSFRLDGIPPAPRGV
PQIEVKFDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVDTMVQEAERFAKEDKEK
RDAIDTKNQADSVVYQTEKQLKELGEKIPGPVKEKVEAKLQELKEKIASGSTQEIKDTMA
ALNQEVMQIGQSLYNQPQPGGADSPPGGEASSSSDTSSSAKGGDNGGDVIDADFTDSN

www.000webhost.com

Other information
Ka divergence:0.17869KaKs divergence:0.152542
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):2157Length 2 (bp):2157Length divergence:0
MFE 1 (kcal):-706.96MFE 2 (kcal):-671.54MFE divergence-0.026