Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G24920-AT5G50460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):secE/sec61-gamma protein transport protein
Function (paralog2):secE/sec61-gamma protein transport protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.60138599762701
Log2 mRNA fold difference:0.9781719654453
Log2 TE fold difference:-0.38174746912342
Sequences
Protein sequence

MDAIDSVVDPLRDFAKDSIRLVKRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLIFIP
INNIIVGAT

MDAIDSVVDPLRDFAKDSIRLVKRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLIFIP
INNIIVGAT

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):210Length 2 (bp):210Length divergence:0
MFE 1 (kcal):-52.3MFE 2 (kcal):-78.6MFE divergence0.201