Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G25500-AT5G52040
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arginine/serine-rich splicing factor 35
Function (paralog2):RNA-binding (RRM/RBD/RNP motifs) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.0286046832121
Log2 mRNA fold difference:1.0517622040384
Log2 TE fold difference:0.9258914113077
Sequences
Protein sequence

MKPVFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEF
GRKGRRLRVEWTKSERGGDKRSGGGSRRSSSSMRPSKTLFVINFDADNTRTRDLEKHFEP
YGKIVNVRIRRNFAFIQYEAQEDATRALDASNNSKLMDKVISVEYAVKDDDARGNGHSPE
RRRDRSPERRRRSPSPYKRERGSPDYGRGASPVAAYRKERTSPDYGRRRSPSPYKKSRRG
SPEYGRDRRGNDSPRRRERVASPTKYSRSPNNKRERMSPNHSPFKKESPRNGVGEVESPI
ERRERSRSSPENGQVESPGSIGRRDSDGGYDGAESPMQKSRSPRSPPADE

MKPVFCGNFEYDARESDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEY
GRTGRRLRVEWTKNDRGGAGRSGGSRRSSSGLRPSKTLFVINFDAQNTRTRDLERHFEPY
GKIVNVRIRRNFAFIQYEAQEDATRALDATNSSKLMDKVISVEYAVKDDDSRGNGYSPER
RRDRSPDRRRRSPSPYRRERGSPDYGRGASPVAHKRERTSPDYGRGRRSPSPYKRARLSP
DYKRDDRRRERVASPENGAVRNRSPRKGRGESRSPPPYEKRRESRSPPPYEKRRESRSPP
PYEKRRERSRSRSKSSPENGQVESPGQIMEVEAGRGYDGADSPIRESSPSRSPPAEE

www.000webhost.com

Other information
Ka divergence:0.112973KaKs divergence:-0.166721
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1053Length 2 (bp):1074Length divergence:0.01
MFE 1 (kcal):-320.26MFE 2 (kcal):-349.75MFE divergence0.044