Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G25630-AT5G52490
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):fibrillarin 2
Function (paralog2):Fibrillarin family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-5.3174628963646
Log2 mRNA fold difference:-6.9340654174241
Log2 TE fold difference:1.7151211982665
Sequences
Protein sequence

MRPPLTGSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRG
GARGGRGPAGRGGMKGGSKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQ
NEDGTKTEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEG
CVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARI
LALNASYFLKSGGHFVISIKANCIDSTVPAEAVFQTEVKKLQQEQFKPAEQVTLEPFERD
HACVVGGYRMPKKPKAATAA

MKPPQRGRGGGVRGGRGLARGGEGSAVRGSGRGGESGRGRGPGRVKSESDGGIKGGSKVL
VTPHRHAGVFVAKSKADALVTKNLVPGEIIYNEKRIFVQNEDRSTVEYRVWNPHRSKLAD
AITTGVDNIWIKPGVKVLYLGASSGYTVSHVSDIVGPEGCVYAVEHSDICGKVLMNMAEK
RTNVIPIIEDARHPAKYRMLVGMVDIIFSDVNHPEQANILSLNASYFLKSGGHFMISIKA
NSIDSTIAAETVYQMEVEKLQMEELRPTEILHLDSCEEKHACVFGGYRLPRK

www.000webhost.com

Other information
Ka divergence:0.690997KaKs divergence:0.318291
GC content 1 (%):49GC content 2 (%):42GC content divergence:-0.077
Length 1 (bp):963Length 2 (bp):879Length divergence:-0.046
MFE 1 (kcal):-333.1MFE 2 (kcal):-262.5MFE divergence-0.119