Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G25670-AT4G25690
Species:Arabidopsis
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.63225528012213
Log2 mRNA fold difference:0.2087918373873
Log2 TE fold difference:0.42625983999911
Sequences
Protein sequence

MDHTVCKQVQPVVRKAKKKHGKDEFDRIKQAEKKKRRLEKALATSAAIRAELEKKKQKRL
EEQQRLDEEGAAIAEAVALHVLLGEDSDDSSRVKFGEEKGFTMDLFRDERTNYVPRQSCA
SYAVQGIGFVSNGYGLGDSNWSPFTRRGAWDNNMGISADLIAAQAVSALQISENADGNAF
VFNGMFRG

MDHTLCKQVVQPVTRKVKKHGKDEFDRIKQAEKKKRRLEKALATSAAIRAELEKKKQKRL
EEQQRLDEEGAAIAEAVALHVLLGEDSDDSSRVKFGEETGFGMDLFRDERTNYVPRQSCA
SYAVQGIGFVSNGYGLGDSNWSVSYKPFMKDVWDNNMVISADLIAAQAVSSLQISEDADR
NAYVFETMFGG

www.000webhost.com

Other information
Ka divergence:0.663136KaKs divergence:-0.880089
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):567Length 2 (bp):576Length divergence:0.008
MFE 1 (kcal):-164.21MFE 2 (kcal):-161MFE divergence-0.01