Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G26580-AT5G55970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):RING/U-box superfamily protein
Function (paralog2):RING/U-box superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.7856657677205
Log2 mRNA fold difference:2.0014701950285
Log2 TE fold difference:-0.25995567472284
Sequences
Protein sequence

MSTRYSSQLQSSAINSITVSSSSSFASTQLDDNTHTAPESSPSSSFFMRLAMRVSRARWF
IFLRRVFHYQNASRSDLGTNPFNSIAWMVSELIALLLQITVITSTLALSKNERPVWPMRL
WITGYNVGCLLNLMLLYGRYRQQDTSHENAFSFGDIEQQQRSREETTRCSHLMNKCRTSL
ELFFAIWFVIGNVWVFDSRFGSFHYAPILHVLCISLLAWNALCYSFPFLLFLLLCCVVPL
VSSFLGYNMNVGSSEKGASDDQISSLPSWKYKLIDETSDSSQANNDPECCICLAKYKEKE
EVRKLPCSHRFHLKCVDQWLRIISCCPLCKQDLPN

MNTRYSNQPELSSSNITITISSSALLSSSPRGDNSHVAAANGQERSPSSFYIRLAMKVSR
ARWFIFLRRVFHYQNGSRSDLGSNPFNSSTWMMSELIALLVQLTVITFTLAISKEERPIW
PVRLWITGYDVGCLLNLMLLYGRYRQLDINQGNGFVLGDVEQQQRGREETRSSHLMNKCR
TSLELFFAIWFVIGNVWVFDSRFGSFHHAPKLHVLCVSLLAWNAICYSFPFLLFLFLCCL
VPLISSLLGYNMNMGSSDRAASDDQISSLPSWKFKRIDDSASDSDSDSATVTDDPECCIC
LAKYKDKEEVRKLPCSHKFHSKCVDQWLRIISCCPLCKQDLPR

www.000webhost.com

Other information
Ka divergence:-0.145442KaKs divergence:-0.0416229
GC content 1 (%):44GC content 2 (%):42GC content divergence:-0.023
Length 1 (bp):1008Length 2 (bp):1032Length divergence:0.012
MFE 1 (kcal):-279.96MFE 2 (kcal):-298.8MFE divergence0.033