Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G26620-AT5G55900
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Sucrase/ferredoxin-like family protein
Function (paralog2):Sucrase/ferredoxin-like family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-2.3875888507512
Log2 mRNA fold difference:-2.8252249635958
Log2 TE fold difference:0.44846930268269
Sequences
Protein sequence

MGSGRDRDDPLSFTSNPSTASSPVTVSDYLDNFLGEPTSRSGSFQSESLLGGGGGESIND
ADFGFARPDFRSEQLAGTVQFYERHVFLCYKKPSVWPARIEAAEFDRLPRLLSAAVSARK
GSMKKETRLTICEGHDGTETSNGDVLIFPDMIRYRRLTHFDVETFVEEVLVKDGEWLPGN
PELLKGSYVFVCSHGSRDRRCGVCGPSLVSRFREELEFHGLQGKVSISPCSHIGGHKYAG
NVIIYRSNINREVTGHWYGYVTPEDVPILLEQHINKGEIVDRLWRGEMGLSEEDQKKTQE
GRFQLNGTVHSVKINGKVSQESSVHNADVSCCQSRAAEPNGCCQQNGNSSSCCQDDTTLM
LSLGTSEDNQLESENNTEKLTPGRKIAEKTFFRINSDKGSSTRKVCGIPTWLESWEREDT
YAALAVVCAAASVAVAYTCYKQL

MGSGRYLDDPLTFTRNPPSSSSPITESSFLAESISRSGSFESGSLRGGDGDCFSDVDFAL
DKLAGTVQFYERHVFLCYKKPSVWPARIEASEFDRLPRLLSSVISARKSSMKKETLLTIC
EGHDGSETSNGDVLIFPDMIRYRRLTHFDVDTFVEEVLVKGVEWLPGNPESLSSSYVFVC
CHGSRDRRCGVCGPSLVSRFREEIDSCGLRGEVSVSPCSHIGGHKYTGDVIIYGLNINQR
VTGHWYGCVTLEDVPLLLEQHINKGEIVDRLWRGEMGLPEEDQKKTQEQRLQLNSEKISN
REVTQESVNNSICCQSRAVPELNGSGCQQNGNSSYCLEEIHTEKNTSERVTSVKNASLRI
GSSENGSSGGFKVCAVMSMWLETWEREDTYAALAVACAAASVAIAYNCYKQLK

www.000webhost.com

Other information
Ka divergence:0.431537KaKs divergence:0.148195
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):1332Length 2 (bp):1242Length divergence:-0.035
MFE 1 (kcal):-427MFE 2 (kcal):-397.85MFE divergence-0.035