Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G26630-AT5G55660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DEK domain-containing chromatin associated protein
Function (paralog2):DEK domain-containing chromatin associated protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.81223170526536
Log2 mRNA fold difference:-1.1073894114135
Log2 TE fold difference:0.29262550841851
Sequences
Protein sequence

MGEDTKATIEPTANKTTSLEKPSEAMAGKENAGGKETQELAKDEDMAEPDNMEIDAQIKK
DDEKAETEDKESEVKKNEDNAETQKMEEKVEVTKDEGQAEATNMDEDADGKKEQTDDGVS
VEDTVMKENVESKDNNYAKDDEKETKETDITEADHKKAGKEDIQHEADKANGTKDGNTGD
IKEEGTLVDEDKGTDMDEKVENGDENKQVENVEGKEKEDKEENKTKEVEAAKAEVDESKV
EDEKEGSEDENDNEKVESKDAKEDEKEETNDDKEDEKEESKGSKKRGKGTSSGGKVREKN
KTEEVKKDAEPRTPFSDRPVRERKSVERLVALIDKDSSKEFRVEKGRGAYLKDIPNVANK
VMRKRSDETLKLLHPILFGGRRGKAAQIKTNILGFSGFVWHGDEKKAKEKVKEKLEKCTK
EKLWEFCDVLDIHITKATTKKEDIITKLFEFLEKPHVTGDVTGDTTVSEKEKSSKGAKRK
RTPKKTSPTAGSSSSKRSAKSQKKSEEATKVVKKSLAHSDDESEEEKEEEEKQEEEKAEE
KEEKKEEENENGIPDKSEDEAPQPSESEEKDESEEHSEEETTKKKRGSRLSAGKKESAGR
ARNKKAVVAAKSSPPEKITQKRSSAKRKKTDDDSDTSPKASSKRKKSENPIKASPAPSKS
ASKEKPVKRAGKGKDKPSDKVLKNAIVEILKRVDFSTATFTDILKELAKEFTEDLTPRKS
SIKMIIQEELTKLADEEEEEEKKEEDSEKEEAGGSGGGEEVKA

MGEEDTKVIVEPTANGTSSLQKTSDAISGKEVQENASGKEVQESKKEEDTGLEKMEIDDE
GKQHEGESETGDKEVEVTEEEKKDVGEDKEQPEADKMDEDTDDKNLKADDGVSGVATEED
AVMKESVESADNKDAENPEGEQEKESKEEKLEGGKANGNEEGDTEEKLVGGDKGDDVDEA
EKVENVDEDDKEEALKEKNEAELAEEEETNKGEEVKEANKEDDVEADTKVAEPEVEDKKT
ESKDENEDKEEEKEDEKEESMDDKEDEKEESNDDDKEDEKEESNDDKEDKKEDIKKSNKR
GKGKTEKTRGKTKSDEEKKDIEPKTPFFSDRPVRERKSVERLVAVVDKDSSREFHVEKGK
GTPLKDIPNVAYKVSRKKSDEVFKQLHTILFGGKRVKATQLKAHILRFSGYKWQGDEEKA
KLKVKEKFEKINKEKLLEFCDLFDISVAKATTKKEDIVTKLVEFLEKPHATTDVLVNEKE
KGVKRKRTPKKSSPAAGSSSSKRSAKSQKKTEEATRTNKKSVAHSDDESEEEKEDDEEEE
KEQEVEEEEEENENGIPDKSEDEAPQLSESEENVESEEESEEETKKKKRGSRTSSDKKES
AGKSRSKKTAVPTKSSPPKKATQKRSAGKRKKSDDDSDTSPKASSKRKKTEKPAKEQAAA
PLKSVSKEKPVIGKRGGKGKDKNKEPSDEELKTAIIDILKGVDFNTATFTDILKRLDAKF
NISLASKKSSIKRMIQDELTKLADEAEDEEGEEEDAEHEEEEEKEKAKGSGGGEEVKA

www.000webhost.com

Other information
Ka divergence:-0.134716KaKs divergence:-0.421525
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2292Length 2 (bp):2337Length divergence:0.01
MFE 1 (kcal):-559.73MFE 2 (kcal):-532.74MFE divergence-0.025