Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G26850-AT5G55120
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):mannose-1-phosphate guanylyltransferase (GDP)s;GDP-galactose:mannose-1-phosphate guanylyltransferases;GDP-galactose:glucose-1-phosphate guanylyltransferases;GDP-galactose:myoinositol-1-phosphate guany
Function (paralog2):galactose-1-phosphate guanylyltransferase (GDP)s;GDP-D-glucose phosphorylases;quercetin 4'-O-glucosyltransferases

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.0574773245514
Log2 mRNA fold difference:0.13265686468903
Log2 TE fold difference:-1.1809624585378
Sequences
Protein sequence

MLKIKRVPTVVSNYQKDDGAEDPVGCGRNCLGACCLNGARLPLYACKNLVKSGEKLVISH
EAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTACETKVIPGKYGFVAQLNEGRHLKKRPT
EFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAGEDAQVQFFPCMPIDPENSPSVVAINVS
PIEYGHVLLIPRVLDCLPQRIDHKSLLLAVHMAAEAANPYFRLGYNSLGAFATINHLHFQ
AYYLAMPFPLEKAPTKKITTTVSGVKISELLSYPVRSLLFEGGSSMQELSDTVSDCCVCL
QNNNIPFNILISDCGRQIFLMPQCYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKE
DYEGASEDNAWRLLAEASLSEERFKEVTALAFEAIGCSNQEEDLEGTIVHQQNSSGNVNQ
KSNRTHGGPITNGTAAECLVLQ

MLLKIKRVPTVVSNYQKDETVEEGGCGRNCLSKCCINGARLPLYTCKNLDKSVGENTESP
VTFLESLVIGEWEDRFQRGLFRYDVTACETKVIPGKYGFIAQLNEGRHLKKRPTEFRVDK
VLQPFDGNKFNFTKVGQEELLFQFKASTNDDDSEIQFLASMPLDADNSPSVVAINVSPIE
YGHVLLIPRVLDCLPQRIDHKSLLLALQMAAEADNPYFRLGYNSLGAFATINHLHFQAYY
LAMQFPIEKASSLKITTTNNGVKISKLLNYPVRGLLVEGGNTIKDLADTVSDASVCLQNN
NIPFNILISDSGKRIFLLPQCYAEKQALGEVSSTLLDTQVNPAVWEMSGHMVLKRKEDYE
GASEEKAWRLLAEVSLSEERFREVNTMIFDAIGFSSHEEEEEEELEEQNSMNGGSFTIVH
CPSVKEEAVSN

www.000webhost.com

Other information
Ka divergence:-0.315761KaKs divergence:-0.664573
GC content 1 (%):47GC content 2 (%):42GC content divergence:-0.056
Length 1 (bp):1329Length 2 (bp):1296Length divergence:-0.013
MFE 1 (kcal):-427.8MFE 2 (kcal):-392.86MFE divergence-0.043