Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G27100-AT5G54780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Ypt/Rab-GAP domain of gyp1p superfamily protein
Function (paralog2):Ypt/Rab-GAP domain of gyp1p superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.2977761927118
Log2 mRNA fold difference:1.0822053557026
Log2 TE fold difference:0.21148921851931
Sequences
Protein sequence

MWGGAGEPADSYYQVRPECTDVPKTRFKIKPGKTLSVRKWQAVFVQEGSLHIGKTLRRIR
RGGIHPSIRGEVWEFLLGCYDPMSTFEEREQIRQRRRLQYASWKEECKQMFPVIGSGRFT
TAPVITENGQPNYDPLVLQEINLGTNSNGSVFFKELTSRGPLDKKIIQWLLTLHQIGLDV
NRTDRALVFYEKKENLSKLWDILSVYAWIDNDVGYCQGMSDLCSPMIILLEDEADAFWCF
ERLMRRLRGNFRSTGRSVGVEAQLTHLSSITQVVDPKLHQHLDKLGGGDYLFAIRMLMVQ
FRREFSFCDSLYLWEMMWALEYDPDLFYVYEAHQCGNEKTEGLKGKPKSIKQCGKYERQN
MRNGGKSAEGPLPISVFLVASVLKDKSYKLMTEARGLDDVVKILNDTTGNLDAKKTCSGA
IKIHKRYLRKVISMFL

MWGAAAEPADSYYLIRPECTDVPNTKFKIKPGKTLSVRKWQAAFTTEGFLDIGKTLSRIQ
RGGIHPSIRGEVWEFLLGCYDPKSTFEEREQIRQRRRLQYASWKEECKQMFPVIGSGGFI
TAPVITNKGEPIYDPIVLQETNLGANGSDFFKDLASRGPLDQKVIQWLLTLHQIGLDVNR
TDRTLVFYEKKENLSKLWDILALYAWIDNDVGYCQGMSDLCSPMIMLLEDEADAFWCFER
LMRRLRGNFRDTGRSVGVEAQLTHLASITQIIDPKLHHHLEKLGGGDYLFAIRMIMVQFR
REFSFCDSLYLWEMMWALEYDPEMYSLYEEPQFEGERIEGSSKGKPKSINQCGKYERENM
KNGGKSAEGPLPISVFLVASVLKDKSSKLMTEARGLDDVVKILNDITGNLDAKKACTGAM
KLHKKYLKKAKK

www.000webhost.com

Other information
Ka divergence:-0.168474KaKs divergence:-0.239843
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1311Length 2 (bp):1299Length divergence:-0.005
MFE 1 (kcal):-365.35MFE 2 (kcal):-367.1MFE divergence0.002