Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G27130-AT5G54760
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Translation initiation factor SUI1 family protein
Function (paralog2):Translation initiation factor SUI1 family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.69650665916065
Log2 mRNA fold difference:0.53988662711352
Log2 TE fold difference:0.16324205329194
Sequences
Protein sequence

MSELDSQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL
KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF

MSELDSQVPTAFDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKIL
KDLKKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:0.989637
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):342Length 2 (bp):342Length divergence:0
MFE 1 (kcal):-100.7MFE 2 (kcal):-90.8MFE divergence-0.052