Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G27180-AT5G54670
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):kinesin 2
Function (paralog2):kinesin 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.54858539658745
Log2 mRNA fold difference:-0.06815000244398
Log2 TE fold difference:-0.47538749715005
Sequences
Protein sequence

MVGEMTNNGRIRPSFPVKDLTSNEGSEYGGPVEFTREDVETLLHERIKYKSKYNYKERCE
NTMDYVKRLRLCIRWFQELELDYAFEQEKLKNAMEMNEKHCADLEVNLKVKEEELNMVID
ELRKNFASVQVQLAKEQTEKLAANESLGKEREARIAVESLQAAITEELAKTQGELQTANQ
RIQAVNDMYKLLQEYNSSLQLYNSKLQGDLDEAHENIKRGEKERTGIVESIGNLKGQFKA
LQDQLAASKVSQDDVMKQKDELVNEIVSLKVEIQQVKDDRDRHITEIETLQAEATKQNDF
KDTINELESKCSVQNKEIEELQDQLVASERKLQVADLSTFEKMNEFEEQKESIMELKGRL
EEAELKLIEGEKLRKKLHNTIQELKGNIRVFCRVRPLLSGENSSEEAKTISYPTSLEALG
RGIDLLQNGQSHCFTFDKVFVPSASQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTY
TMMGRPGNPDEKGLIPRCLEQIFQTRQSLRSQGWKYELQVSMLEIYNETIRDLLSTNKEA
VRADNGVSPQKYAIKHDASGNTHVVELTVVDVRSSKQVSFLLDHAARNRSVGKTAMNEQS
SRSHFVFTLKISGFNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRLKETQAINKSLSSL
GDVIFALAKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNITPEPSSTGESLCSLRFAAR
VNACEIGTAHRHVNARPLDYRLSLG

MVGAMANNGRIRSAFPVTNGSKDLTPNSAPASTTGSEYGPVEFTREDVETLLNERIKYKS
KFNYKERCENMMDYIKRLRLCIRWFQELELDYAFEQEKLKNALELNEKHCVDMEVSLKNK
EEELNMIIEELRKNFESVQVQLAREQTEKLAANDSLGKEKEARLSVEKAQAGLTEELGKA
QGDLQTANQRIQSVNDMYKLLQEYNSSLQLYNSKLQGDLDEAHETIKRGEKERTAIIENI
GNLKGQFSALQEQLAASKASQEDIMKQKGELVNEIASLKVELQQVKDDRDRHLVEVKTLQ
TEATKYNDFKDAITELETTCSSQSTQIRQLQDRLVNSERRLQVSDLSTFEKMNEYEDQKQ
SIIDLKSRVEEAELKLVEGEKLRKKLHNTILELKGNIRVFCRVRPLLPGENNGDEGKTIS
YPTSLEALGRGIDLMQNAQKHAFTFDKVFAPTASQEDVFTEISQLVQSALDGYKVCIFAY
GQTGSGKTYTMMGRPGNVEEKGLIPRCLEQIFETRQSLRSQGWKYELQVSMLEIYNETIR
DLLSTNKEAVRTDSGVSPQKHAIKHDASGNTHVAELTILDVKSSREVSFLLDHAARNRSV
GKTQMNEQSSRSHFVFTLRISGVNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRLKETQ
AINKSLSSLGDVIFALAKKEDHVPFRNSKLTYLLQPCLGGDAKTLMFVNIAPESSSTGES
LCSLRFAARVNACEIGTPRRQTNIKPLENRLSLG

www.000webhost.com

Other information
Ka divergence:-0.0957592KaKs divergence:-0.741948
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2238Length 2 (bp):2265Length divergence:0.006
MFE 1 (kcal):-635.66MFE 2 (kcal):-669.69MFE divergence0.026