Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G27585-AT5G54100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SPFH/Band 7/PHB domain-containing membrane-associated protein family
Function (paralog2):SPFH/Band 7/PHB domain-containing membrane-associated protein family

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.11694190643358
Log2 mRNA fold difference:-0.13371141005944
Log2 TE fold difference:0.0050722035955304
Sequences
Protein sequence

MNHLVRKSSVGYSALRSVSYLRQSAVTSPPPIFSAAASTVRQFTSAGYPSNSFQLTPPTN
WGIRIVPERKAFVIERFGKYATTLPSGIHFLIPFVDRIAYVHSLKEEAIPIPNQTAITKD
NVSIHIDGVLYVKIVDPKLASYGVESPIYAVVQLAQTTMRSELGKITLDKTFEERDTLNE
KIVEAINVAAKDWGLQCLRYEIRDIMPPHGVRAAMEMQAEAERKKRAQILESEGERQSHI
NIADGKKSSVILASEAAKMDQVNRAQGEAEAILARAQATAKGLVLLSQSLKETGGVEAAS
LRVAEQYITAFGNIAKEGTIMLLPSGASNPASMIAQALTMYKSLVINGPSKDHQETQALD
ETDLEELEDMGEKHISEGSNNRSGSISFDTEKPGHTGEPRFSLQNRNKDPQ

MNQLALSRSGYTAAVRFLPMLSAAVPKILSSLAAASTVRNFSSTGSPLTSYQINKPSPSK
SFTSRLLHQSSSAGTPPQQLFGARSFSSPSSDFNSYHINPPSNWGIRIVPERKACVIERF
GKFHTTLPAGIHFLVPFVDRIAYVHSLKEEAIPIGNQTAITKDNVSIHIDGVLYVKIVDP
KLASYGVENPIYAVMQLAQTTMRSELGKITLDKTFEERDTLNEKIVEAINVAAKDWGLQC
LRYEIRDIMPPNGVRVAMEMQAEAERKKRAQILESEGERQAHINRADGKKSSVILESEAA
MMDQVNRAQGEAEAILARAQATAKGLAMVSQSLKEAGGEEAASLRVAEQYIQAFGKIAKE
GTTMLLPSNVDNPASMIAQALGMYKGLSTKVPTVVSGKLLE

www.000webhost.com

Other information
Ka divergence:0.250023KaKs divergence:-0.13944
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):1236Length 2 (bp):1206Length divergence:-0.012
MFE 1 (kcal):-376.23MFE 2 (kcal):-365.9MFE divergence-0.014