Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G27680-AT5G53540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):P-loop containing nucleoside triphosphate hydrolases superfamily protein
Function (paralog2):P-loop containing nucleoside triphosphate hydrolases superfamily protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.36937538954418
Log2 mRNA fold difference:0.49329913084122
Log2 TE fold difference:-0.12573306657359
Sequences
Protein sequence

MGGSSETKILQELILYAASAAFSCLVLFAGLRHLDPNREASKKALEHKKEISKRLGRPLV
QTNPYEDVIACDVINPDHIDVEFGSIGGLETIKQALYELVILPLKRPELFAYGKLLGPQK
GVLLYGPPGTGKTMLAKAIAKESGAVFINVRVSNLMSKWFGDAQKLVSAVFSLAYKLQPA
IIFIDEVESFLGQRRSTDHEAMANMKTEFMALWDGFSTDPHARVMVLAATNRPSELDEAI
LRRLPQAFEIGIPDRRERAEILKVTLKGERVEPDIDFDHIARLCEGYTGSDIFELCKKAA
YFPIREILDAERKGKPCLDPRPLSQLDLEKVLATSKKTQVAAGEYSLSSQSSAWRGSREP
DEVQAAISGISKLLVSQIINLQSESQDSWQRDPEEDSR

MKRSSGRKDSNFIEQLILYVASAALSSLVLYVGLRQLDPNRDAAKKSLEHKREIAKRLGR
PLIQTNQYEDVIACDVINPLHIDVEFGSIGGLESIKQALYELVILPLKRPELFAYGKLLG
PQKGVLLYGPPGTGKTMLAKAIARESEAVFINVKVSNLMSKWFGDAQKLVSAVFSLAYKL
QPAIIFIDEVDSFLGQRRSTDNEAMSNMKTEFMALWDGFTTDQNARVMVLAATNRPSELD
EAILRRFPQSFEIGMPDCQERAQILKVVLKGESVESDINYDRIARLCEDYTGSDIFELCK
KAAYFPIREILEAEKEGKRVSVPRPLTQLDLEKVLATSKKTQVAASEYTGLSSQSSVWGS
PSNADEVQAAINGISKLFVSQLRNIQPDSQDSYQQHPSEGDSE

www.000webhost.com

Other information
Ka divergence:0.46174KaKs divergence:0.500669
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1197Length 2 (bp):1212Length divergence:0.006
MFE 1 (kcal):-399.12MFE 2 (kcal):-368.62MFE divergence-0.04