Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G30710-AT4G30740
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Family of unknown function (DUF566)
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.4968764024206
Log2 mRNA fold difference:0.76639704412831
Log2 TE fold difference:2.6443541260554
Sequences
Protein sequence

MDVATDTTRRRLLPSDKNNAVVATRRPRTMEVSSRYRSPTPTKNGRCPSPSVTRPTVSSS
SQSVAAKRAVSAERKRPSTPPSPTSPSTPIRDLSIDLPASSRRLSTGRLPESLWPSTMRS
LSVSFQSDSVSVPVSKKERPVSSSSGDRTLRPSSNIAQKHKAETTSVSRKPTPERKRSPL
KGKNNVSDLSENSKPVDGPHSRLIEQHRWPSRIGGKITSNSLNRSLDLGDKASRGIPTSG
PGMGPSLRRMSLPLSSSSRPLHKTSSNTSSYGGLVSPTKSEDNNIARTSGAQRLLSAGSL
DRATLATAVARLHPLPAPGSRPASPSRTSFLSSSSISRGMSTSRGVSPSRGLSPSRGLSP
TRGLSPSRGLSPSRGTNTSCFARPSTPPSRGISPSRIRQTTTSTQSSTTTSVLSFITDVK
KGKKASYIEDVHQLRLLHNRYLQWRFAIARAESVMYIQRLTSEETLFNVWHAISELQDHV
TRQRIGLQQLKLEIKLNSLLNDQMVSLEDWATLERDHVSSLVGAISDLEANTLRLPATGG
TKADTESLKAAMSSALDVMQAMGSSIWSLLSKVEEMNIMVTELAVVVTKESSMQGKCEDL
LASTAIMQIEECSLRTHLIQTRREEGEDAETPPPLLPLSKFPWP

MRILSVSFQSDSVSVPVSKKERLVSSSSGDRTLRPSSNIAQKHKAETTSVSRKPTPERKR
SPLKGKNNVSDLSENSKPVDGPHSRLIEQHR

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:-0.181682
GC content 1 (%):45GC content 2 (%):42GC content divergence:-0.034
Length 1 (bp):1935Length 2 (bp):276Length divergence:-0.75
MFE 1 (kcal):-597.48MFE 2 (kcal):-70.9MFE divergence-0.788