Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G31480-AT4G31490
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Coatomer, beta subunit
Function (paralog2):Coatomer, beta subunit

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.0063483589398406
Log2 mRNA fold difference:-0.1444153644168
Log2 TE fold difference:0.13481514987976
Sequences
Protein sequence

MDKSSTMLVHYDKGTPAVANEIKEALEGNDVEAKVDAMKKAIMLLLNGETIPQLFITIIR
YVLPSEDHTIQKLLLLYLELIEKTDSKGKVLPEMILICQNLRNNLQHPNEYIRGVTLRFL
CRMKETEIVEPLTPSVLQNLEHRHPFVRRNAILAIMSIYKLPQGDQLFVDAPEMIEKVLS
TEQDPSAKRNAFLMLFTCAEERAVNYLLSNVDKVSDWNESLQMVVLELIRSVCKTKPAEK
GKYIKIIISLLSATSSAVIYECAGTLVSLSSAPTAIRAAANTYCQLLLSQSDNNVKLILL
DRLYELKTLHRDIMVELIIDVLRALSSPNLDIRRKTLDISLDLITHHNINEVVQMLKKEV
VKTQSGELEKNGEYRQMLIQAIHACAVKFPEVASTVVHLLMDFLGDSNVASALDVVVFVR
EIIETNPKLRVSIITRLLDTFYQIRAGKVCPCALWIIGEYCLSLSEVESGISTITQCLGE
LPFYSVSEESEPTETSKKIQPTSSAMVSSRKPVILADGTYATQSAASETTFSSPTVVQGS
LTSGNLRALLLTGDFFLGAVVACTLTKLVLRLEEVQSSKTEVNKTVTQALLIMVSMLQLG
QSPVSPHPIDNDSYERIVLCIKLLCHRNDEMKKIWLESCRQSFVKMISEKQLREMEELKA
KTQTTHAQPDDLIDFFHLKSRKGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQL
TGFSDPVYAEAYVTVHHYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAP
ERSMQIKANIKVSSTETGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAF
RTMWAEFEWENKVAVNTTIQNEREFLDHIIKSTNMKCLTAPSAIEGECGFLAANLYAKSV
FGEDALVNVSIEKQTDGALSGYIRIRSKTQGIALSLGDKITLKQKGSS

MDKSSTMLVHYDKGTPAVANEIKEALEGNDVEAKVDAMKKAIMLLLNGETIPQLFITIIR
YVLPSEDHTIQKLLLLYLELIEKTDSKGKVLPEMILICQNLRNNLQHPNEYIRGVTLRFL
CRMKETEIVEPLTPSVLQNLEHRHPFVRRNAILAIMSIYKLPHGDQLFVDAPEMIEKVLS
TEQDPSAKRNAFLMLFTCAEERAVNYLLSNVDKVSDWNESLQMVVLELIRSVCKTKPAEK
GKYIKIIISLLSATSSAVIYECAGTLVSLSSAPTAIRAAANTYCQLLLSQSDNNVKLILL
DRLYELKTLHRDIMVELIIDVLRALSSPNLDIRRKTLDIALDLITHHNINEVVQMLKKEV
VKTQSGELEKNGEYRQMLIQAIHACAVKFPEVASTVVHLLMDFLGDSNVASALDVVVFVR
EIIETNPKLRVSIITRLLDTFYQIRAGKVCPCALWIIGEYCLSLSEVESGISTITQCLGE
LPFYSVSEESEPTETSKKIQPTSSAMVSSRKPVILADGTYATQSAASETTFSSPTVVQGS
LTSGNLRALLLTGDFFLGAVVACTLTKLVLRLEEVQSSKTEVNKTVSQALLIMVSILQLG
QSPVSPHPIDNDSYERIMLCIKLLCHRNVEMKKIWLESCRQSFVKMISEKQLREMEELKA
KTQTTHAQPDDLIDFFHLKSRKGMSQLELEDQVQDDLKRATGEFTKDENDANKLNRILQL
TGFSDPVYAEAYVTVHHYDIALEVTVINRTKETLQNLCLELATMGDLKLVERPQNYSLAP
ERSMQIKANIKVSSTETGVIFGNIVYETSNVMERNVVVLNDIHIDIMDYISPAVCSEVAF
RTMWAEFEWENKVAVNTTIQNEREFLDHIIKSTNMKCLTAPSAIAGECGFLAANLYAKSV
FGEDALVNLSIEKQTDGTLSGYIRIRSKTQGIALSLGDKITLKQKGGS

www.000webhost.com

Other information
Ka divergence:0.469526KaKs divergence:-0.999962
GC content 1 (%):42GC content 2 (%):42GC content divergence:0
Length 1 (bp):2847Length 2 (bp):2847Length divergence:0
MFE 1 (kcal):-839.9MFE 2 (kcal):-843.23MFE divergence0.002