Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT4G35660-AT4G35680
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Arabidopsis protein of unknown function (DUF241)
Function (paralog2):Arabidopsis protein of unknown function (DUF241)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.67870210607865
Log2 mRNA fold difference:0.18376318840923
Log2 TE fold difference:0.4721331569451
Sequences
Protein sequence

MAESSSSSVATTHVPARSISLPTRLIHPKAQRVEEELKKIQALNSSSSASSRIQLGLAKL
VELYDFVNEQVISSPQGQQALRLCRNRKLVEDALDESIVLLDVSDFTRDLIGTLMEHIQE
LQSALRRRRGNLSSVQSEIRSYISFHKKSKTEAARQVKSLARRQTKKKAWVIKQSGGLDE
HSSMVSNILRQSNASTISILQSLLQFLSTSGENNEKKNGEIGCVDNSMIRSFFGRIIGRK
MVKEIDAQTILGRLAMVNVSLEAIKDELSYLSRRLIQHRASLLNIVTL

MEGLDSVFLSNQTTHQPVRSASLPSRIHPLSVKLRTALSRLSIWRRSSSSISVSASFGYE
TVLVGLVNLTELYGCVHELLESPYVKHTLLHHQEGKLLDESLDGSVLLLDVYEGTREVIV
AMREHVTNLKSALRRKGSLEKEAKAYFNLRKKAKKEISKQINALKKMETRDISTNTDQDS
AIASTSVLRETIQITVSMFRHLLLFLSTIPPPPSPAIFKTTIGLLSIPFVSPSLSDKSLI
LIKEMKSLDDVFLGSILDSRKTLFEVETMENEKMRRDVVEDGFRDLEAELDSVSKCLVKN
RVLFLNILNLVCEISQHHSSREFGSMSWKGGRGKPKGYGGDYGKPEPFVIFPEITLPDPK
SISTDSQLVVVQSYFTFNKFWMNSPYHLCDGGVSKKEKASLDIERPDNFSKELVGDTRRE
QRPVKRAKWSQEADLQKLDVFEKLESKFKTQGNEEKEDGEDDEQVVESEGEESDNGDYDQ
NQDFDDDEDDYNHEEDGGFEEVY

www.000webhost.com

Other information
Ka divergence:0.200791KaKs divergence:0.00935673
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):867Length 2 (bp):1512Length divergence:0.271
MFE 1 (kcal):-239.02MFE 2 (kcal):-447.9MFE divergence0.304