Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G09410-AT5G64220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):ethylene induced calmodulin binding protein
Function (paralog2):Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:1.2967936639
Log2 mRNA fold difference:0.82225067231695
Log2 TE fold difference:0.47498434459397
Sequences
Protein sequence

MARKKKSVSFSHLDIARNEGNKIISFSVHAYSDRLGFVDSLFDYESLRSLLVDFWVYPSM
VDRRSFGSITPPLQLDMEQLLSEAQHRWLRPTEICEILQNYHKFHIASESPTRPASGSLF
LFDRKVLRYFRKDGHNWRKKKDGKTIREAHEKLKVGSIDVLHCYYAHGEANENFQRRCYW
MLEQYYYRKASSHWVLVATLSLFSFGYLRPSWVRHLMHIVFVHYLEVKGNRTSIGMKENN
SNSVNGTASVNIDSTASPTSTLSSLCEDADTVLVQGIVNKQVPSYDHLLNLKLEIAMVGH
LLLACVMFHRFMGTESEKMQPSNTDSMLVEENSEKGGRLKAEHIRNPLQTQFNWQDDTDL
ALFEQSAQDNFETFSSLLGSENLQPFGISYQAPPSNMDSEYMPVMKILRRSEDSLKKVDS
FSKWAIKELGEMEDLQMQSSRGDIAWTTVECETAAAGISLSPSLSEDQRFTIVDFWPKSA
KTDAEVEVMVIGTFLLSPQEVTKYNWSCMFGEVEVPAEILVDGVLCCHAPPHTAGHVPFY
VTCSNRFACSEVREFDFLSGSTQKINATDVYGTYTNEASLQLRFEKMLAHRDFVHEHHIF
EDVGDKRRQISKIMLLKEEKEYLLPGTYQRDSTKQEPKGQLFRELFEEELYIWLIHKVTE
EGKGPNILDEDGQGILHFVAALGYDWAIKPVLAAGVNINFRDANGWSALHWAAFSGREET
VAVLVSLGADAGALTDPSPELPLGKTAADLAYANGHRGISGFLAESSLTSYLEKLTVDSK
ENSPANSCGEKAVQTVSERTAAPMTYGDVPEKLSLKDSLTAVRNATQAADRLHQVFRMQS
FQRKQLCDIGDDEKIDISDQLAVSFAASKTKNPGQGDVSLSCAATHIQKKYRGWKKRKEF
LLIRQRIVKIQAHVRGHQVRKQYRTVIWSVGLLEKIILRWRRKGNGLRGFKRNAVAKTVE
PEPPVSAICPRIPQEDEYDYLKEGRKQTEERLQKALTRVKSMVQYPEARDQYRRLLTVVE
GFRENEASSSASINNKEEEAVNCEEDDFIDIESLLNDDTLMMSISP

MADRGSFGFAPRLDIKQLLSEAQHRWLRPAEICEILRNHQKFHIASEPPNRPPSGSLFLF
DRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRRCYWML
EQDLMHIVFVHYLEVKGNRMSTSGTKENHSNSLSGTGSVNVDSTATRSSILSPLCEDADS
GDSRQASSSLQQNPEPQTVVPQIMHHQNASTINSYNTTSVLGNRDGWTSAHGNRVKGSNS
QRSGDVPAWDASFENSLARYQNLPYNAPLTQTQPSTFGLIPMEGKTEKGSLLTSEHLRNP
LQSQVNWQTPVQESVPLQKWPMDSHSGMTDATDLALFGQGAHENFGTFSSLLGSQDQQSS
SFQAPFTNNEAAYIPKLGPEDLIYEASANQTLPLRKALLKKEDSLKKVDSFSRWVSKELG
EMEDLQMQSSSGGIAWTSVECENAAAGSSLSPSLSEDQRFTMIDFWPKWTQTDSEVEVMV
IGTFLLSPQEVTSYSWSCMFGEVEVPADILVDGVLCCHAPPHEVGRVPFYITCSDRFSCS
EVREFDFLPGSTRKLNATDIYGANTIETSLHLRFENLLALRCSVQEHHIFENVGEKRRKI
SKIMLLKDEKEPPLPGTIEKDLTELEAKERLIREEFEDKLYLWLIHKVTEEGKGPNILDE
DGQGVLHLAAALGYDWAIKPILAAGVSINFRDANGWSALHWAAFSGREDTVAVLVSLGAD
AGALADPSPEHPLGKTAADLAYGNGHRGISGFLAESSLTSYLEKLTVDAKENSSADSSGA
KAVLTVAERTATPMSYGDVPETLSMKDSLTAVLNATQAADRLHQVFRMQSFQRKQLSELG
GDNKFDISDELAVSFAAAKTKKSGHSSGAVHAAAVQIQKKYRGWKKRKEFLLIRQRIVKI
QAHVRGHQVRKQYRAIIWSVGLLEKIILRWRRKGSGLRGFKRDTISKPTEPVCPAPQEDD
YDFLKEGRKQTEERLQKALTRVKSMAQYPEARAQYRRLLTVVEGFRENEASSSSALKNNT
EEAANYNEEDDLIDIDSLLDDDTFMSLAFE

www.000webhost.com

Other information
Ka divergence:-0.208695KaKs divergence:0.119359
GC content 1 (%):42GC content 2 (%):44GC content divergence:0.023
Length 1 (bp):3201Length 2 (bp):3153Length divergence:-0.008
MFE 1 (kcal):-945.68MFE 2 (kcal):-994.3MFE divergence0.025