Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G10745-AT5G24980
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.16970747204682
Log2 mRNA fold difference:0.76394111889171
Log2 TE fold difference:-0.80421281431506
Sequences
Protein sequence

MAKEQHLRPWFLDLVPALVVLLAAAHVIALGYWIYRLATDRRAQSQRGKFH

MENSVDLVPAMVVFLAAVHVIALVYWIYRLASDRPPQRKKIQ

www.000webhost.com

Other information
Ka divergence:0.537664KaKs divergence:0.999745
GC content 1 (%):51GC content 2 (%):46GC content divergence:-0.052
Length 1 (bp):156Length 2 (bp):129Length divergence:-0.095
MFE 1 (kcal):-43.11MFE 2 (kcal):-40.4MFE divergence-0.032