Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G10750-AT5G25020
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Protein of unknown function (DUF1336)
Function (paralog2):Protein of unknown function (DUF1336)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.6180771536111
Log2 mRNA fold difference:-3.1689634611235
Log2 TE fold difference:-0.4399903841031
Sequences
Protein sequence

MSPSKQRHRSSTGENKSKPVRSASSSAIPEWITESTNGGSLRRVDPDTGTDGWASPPGDV
FSLRSDSYLSKKQKTPAGDYLLSPAGMDWLKSSTKLENALARPDNRVAHALRKAQSRGQS
LKSFIFAVNLQIPGKDHHSAVFYFATEEPIPSGSLLHRFINGDDAFRNQRFKIVNRIVKG
PWVVKAAVGNYSACLLGKALTCNYHRGPNYFEIDVDISSSAIATAILRLALGYVTSVTID
MGFLAEAQTEEELPERLIGAVRVCQMEMSSAFVVDAPPPQQLPSQPCRTLSSAKVNHDED
ED

MNQTETTTDDDNNNSKPAETESTTTAPEWITETINGGSFCHVDLETGTNGWASPPGNVFS
LRSNNYFTPTKQKSPGGDYLLSLAAVDWLKSTTKKLDHILSRPDNRVIHALKTSQSSSFI
FAVNFQVPGKEHYNLRFKIVSNVVKGPWVVKAAAGKFGAFVAGKAMKCSYHRGDNYFEVD
VDISSSAIMTALIRFMLGYVTYLMVDIGFVVEAQTEEELPERLIGGARICHMELSSAFVI
YDDVDGKKSSQQRRRMMGAAEGNHSEDED

www.000webhost.com

Other information
Ka divergence:0.604179KaKs divergence:0.778358
GC content 1 (%):52GC content 2 (%):47GC content divergence:-0.051
Length 1 (bp):909Length 2 (bp):810Length divergence:-0.058
MFE 1 (kcal):-297.14MFE 2 (kcal):-234.05MFE divergence-0.119