Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G15890-AT5G15900
Species:Arabidopsis
Duplication type:TD
Function (paralog1):TRICHOME BIREFRINGENCE-LIKE 21
Function (paralog2):TRICHOME BIREFRINGENCE-LIKE 19

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.6719452849122
Log2 mRNA fold difference:-1.2761379573991
Log2 TE fold difference:0.59713354897415
Sequences
Protein sequence

MELPLFAILQRTPRVAITLAFVLFVLTIVPALYTLLADPILPPSISSFETDHTRLSHLNS
SSNQIPSPVNGSIPTPPYHTPSKHRKSSFHRIPKPKKGPISSPTDHIPLRQRSSSFDQIP
SPMNSPVPAPPHRNSSADQSPSPVNGPIPAPLNHTSLRHLNSSSDDHSSPVTTSPSRTRI
RDDEQMCDLFTGEWVPNEEAPYYTNTTCWAIHEHQNCMKYGRPDTGFMRWRWKPESCDLP
IFDPQEFLEMVRGKAMGFVGDSISRNQVQSLLCLLSRVEYPEDISPSPDTDFKVWNYTSY
NFTLHVMWSPFLVKATKPDPKSNFFSLYLDEYDTKWTSQLDQLDYLVISSGHWFSRPVIF
YENQQISGCQYCALPNTTELPLTYGYRKALRISLKAIIENFKGLAFLRSFSPQHFEGGAW
NEGGDCVRTQPYRRNETIPEADLKVHDIQREEFRAAEEDGMKKSGLRLKLMDTTQAMLLR
PDGHPGRYGHLQNPNVTLRNDCIHWCLPGPIDTLNDILLQMMKTDN

MELVHSATFPCKQKLLIAVTIATSLLTIIPLLYPLLEDPNFFLKQQPPSQSSIINLENGV
VTSHDSCDIFSGEWVPNPEAPYYTNTTCWAIHEHQNCMKFGRPDTDFIKWKWKPYGCEDG
LPVFDPVRFLEIVRGKTMAFVGDSVSRNHMQSLICLLSQVEYPMDASVKNDDYFKRWTYE
TYNFTIAAFWTPHLVKSKEPDQTQPKHIDIFDLYLDEADESWTADIGDFDFVIISSGHWH
YRPSVYYENRTITGCHYCQLPNITDLTMFYGYRKAFRTAFKAILDSESFKGVMYLRSFAP
SHFEGGLWNEGGDCLRKQPYRSNETQDETTMKLHKIQLEEFWRAEEEAKKKGKRLRLLDT
TQAMWLRPDGHPSRYGHIPEANVTLYNDCVHWCLPGPIDNLNDFLLAMLKREEDKGFLAQ
VRKMLS

www.000webhost.com

Other information
Ka divergence:0.00385912KaKs divergence:-0.209581
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1581Length 2 (bp):1281Length divergence:-0.105
MFE 1 (kcal):-430.8MFE 2 (kcal):-356.6MFE divergence-0.094