Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G22770-AT5G22780
Species:Arabidopsis
Duplication type:TD
Function (paralog1):alpha-adaptin
Function (paralog2):Adaptor protein complex AP-2, alpha subunit

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.16783799405813
Log2 mRNA fold difference:0.01136439843161
Log2 TE fold difference:0.15514354799205
Sequences
Protein sequence

MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH
MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDIIGRNET
FQCLALTLVGNIGGRDFAESLAPDVQKLLISSSCRPLVRKKAALCLLRLFRKNPDAVNVD
GWADRMAQLLDERDLGVLTSSTSLLVALVSNNHEAYSSCLPKCVKILERLARNQDVPQEY
TYYGIPSPWLQVKAMRALQYFPTIEDPSTRKALFEVLQRILMGTDVVKNVNKNNASHAVL
FEALSLVMHLDAEKEMMSQCVALLGKFISVREPNIRYLGLENMTRMLMVTDVQDIIKKHQ
SQIITSLKDPDISIRRRALDLLYGMCDVSNAKDIVEELLQYLSTAEFSMREELSLKAAIL
AEKFAPDLSWYVDVILQLIDKAGDFVSDDIWFRVVQFVTNNEDLQPYAASKAREYLDKIA
IHETMVKVSAYILGEYGHLLARQPGCSASELFSILHEKLPTISTPTIPILLSTYAKLLMH
AQPPDPELQKKVWAVFKKYESCIDVEIQQRAVEYFELSKKGPAFMDVLAEMPKFPERQSS
LIKKAENVEDTADQSAIKLRAQQQPSNAMVLADQQPVNGAPPPLKVPILSGSTDPESVAR
SLSHPNGTLSNIDPQTPSPDLLSDLLGPLAIEAPPGAVSNEQHGPVGAEGVPDEVDGSAI
VPVEEQTNTVELIGNIAERFHALCLKDSGVLYEDPHIQIGIKAEWRGHHGRLVLFMGNKN
TSPLTSVQALILPPAHLRLDLSPVPDTIPPRAQVQSPLEVMNIRPSRDVAVLDFSYKFGA
NVVSAKLRIPATLNKFLQPLQLTSEEFFPQWRAISGPPLKLQEVVRGVRPLALPEMANLF
NSFHVTICPGLDPNPNNLVASTTFYSESTGAILCLARIETDPADRTQLRMTVGTGDPTLT
FELKEFIKEQLITVPMGSRALVPAAGPAPPVAQPPSPAALADDPGAMLAGLL

MTGMRGLSVFISDVRNCQNKEAERLRVDKELGNIRTCFKNEKVLTPYKKKKYVWKMLYIH
MLGYDVDFGHMEAVSLISAPKYPEKQVGYIVTSCLLNENHDFLKLAINTVRNDIIGRNET
FQCLALTLVGNIGGRDFAESLAPDVQKLLISSSCRPLVRKKAALCLLRLFRKNPDAVNVD
GWADRMAQLLDERDLGVLTSSTSLLVALVSNNHEAYSSCLPKCVKILERLARNQDVPQEY
TYYGIPSPWLQVKAMRALQYFPTIEDPSTRKALFEVLQRILMGTDVVKNVNKNNASHAVL
FEALSLVMHLDAEKEMMSQCVALLGKFISVREPNIRYLGLENMTRMLMVTDVQDIIKKHQ
SQIITSLKDPDISIRRRALDLLYGMCDVSNAKDIVEELLQYLSTAEFSMREELSLKAAIL
AEKFAPDLSWYVDVILQLIDKAGDFVSDDIWFRVVQFVTNNEDLQPYAASKAREYMDKIA
IHETMVKVSAYILGEYGHLLARQPGCSASELFSILHEKLPTVSTPTIPILLSTYAKLLMH
AQPPDPELQKKVWAVFKKYESCIDVEIQQRAVEYFELSKKGPAFMDVLAEMPKFPERQSS
LIKKAENVEDTADQSAIKLRAQQQPSNAIVLADPQPVNGAPPPLKVPILSGSTDPESVAR
SLSHPNGTLSNIDPQTPSPDLLSDLLGPLAIEAPPGAVSYEQHGPVGAEGVPDEIDGSAI
VPVEEQTNTVELIGNIAERFHALCLKDSGVLYEDPHIQIGIKAEWRGHHGRLVLFMGNKN
TSPLTSVQALILPPAHLRLDLSPVPDTIPPRAQVQSPLEVMNIRPSRDVAVLDFSYKFGT
NVVSAKLRIPATLNKFLQPLQLTSEEFFPQWRAISGPPLKLQEVVRGVRPLALPEMANLF
NSFHVTICPGLDPNPNNLVASTTFYSETTGAMLCLARIETDPADRTQLRLTVGSGDPTLT
FELKEFIKEQLITIPMGSRALVPAAGPAPSPAVQPPSPAALADDPGAMLAGLL

www.000webhost.com

Other information
Ka divergence:0.0322581KaKs divergence:0.381995
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):3039Length 2 (bp):3042Length divergence:0
MFE 1 (kcal):-917.03MFE 2 (kcal):-904.88MFE divergence-0.007