Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G42500-AT5G42510
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Disease resistance-responsive (dirigent-like protein) family protein
Function (paralog2):Disease resistance-responsive (dirigent-like protein) family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.30256973654959
Log2 mRNA fold difference:-0.1108393280005
Log2 TE fold difference:-0.1956581383939
Sequences
Protein sequence

MAKRFLLLLPLLSTILLLSVSVTESEAYSTTKPCQGYKPDKFTHLHFYFHDVISGDKPTA
VKVAEARRTNSSNVNFGVIMIADDPLTEGPDPSSKEVGRAQGMYALTAMKNISFTMVFNL
AFTAGEFNGSTVAMYGRNEIFSKVREMPIIGGTGAFRFARGYAQAKTYKVVGLDAVVEYN
VFIWH

MAKRFLLLLPLLSSILLLAVSVTAYSTTTPYQGYKPEKFTHLHFYFHDVISGDKPTAVKV
AEARPTTTLNVKFGVIMIADDPLTEGPDPSSKEVGRAQGMYASTAMKDIVFTMVFNYVFT
AGEFNGSTIAVYGRNDIFSKVRELPIIGGTGAFRFARGYALPKTYKIVGLDAVVEYNVFI
WH

www.000webhost.com

Other information
Ka divergence:0.266158KaKs divergence:-0.99861
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):558Length 2 (bp):549Length divergence:-0.008
MFE 1 (kcal):-154.72MFE 2 (kcal):-150.09MFE divergence-0.015