Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G58820-AT5G58830
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Subtilisin-like serine endopeptidase family protein
Function (paralog2):Subtilisin-like serine endopeptidase family protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.070161986210531
Log2 mRNA fold difference:-0.0077981319291061
Log2 TE fold difference:0.070516811432649
Sequences
Protein sequence

MAKRDYFCFVVLFLSSVSAVIDDPQNKQVYVVYMGSLPSLLEYTPLSHHMSILQEVTGDS
SVEGRLVRSYKRSFNGFAARLTESERIRVAEMEGVVSVFPNINYKLQTTASWDFLGLKEG
KNTKRNLAIESDTIIGFIDSGIWPESESFSDKGFGPPPKKWKGVCSGGKNFTCNNKLIGA
RDYTSEGTRDLQGHGTHTASTAAGNAVADASFFGIGNGTARGGVPASRIAAYKVCSEKDC
TAASLLSAFDDAIADGVDLISISLASEFPQKYYKDAIAIGAFHANVKGILTVNSAGNSGS
FPSTTASVAPWILSVAASNTNRGFFTKVVLGNGKTLVGRSVNSFDLKGKKYPLVYGDNFN
ESLVQGKILVSKFPTSSKVAVGSILIDDYQHYALLSSKPFSLLPPDDFDSLVSYINSTRS
PQGTFLKTEAFFNQTAPTVASFSSRGPNFIAVDLLKPDISAPGVEILAAYSPLGSPSEEE
SDKRRVKYSVMSGTSMSCPHVAGVAAYIRTFHPKWSPSVIQSAIMTTAWPMKPNRPGFAS
TEFAYGAGHVDQIAAINPGLVYELDKADHIAFLCGLNYTSKTLHLIAGEAVTCSGNTLPR
NLNYPSMSAKIDGYNSSFTVTFKRTVTNLGTPNSTYKSKIVLNHGAKLVKVSPSVLSFKR
VNEKQSFTVTFSGNLNLNLPTSANLIWSDGTHNVRSVIVVYTT

MVKRASFCLLSCLIILFLSSVSAIIYDPQDKQVYVVYMGSLPSQPNYTPMSNHINILQEV
TGESYKRSFNGFSALLTESEREGVAEMEGVVSVFRSKNYKLQTTASWDFMGMKEGKNTKR
NFAVESDTIIGFIDSGIWPESESFSDKGFGPPPKKWKGVCKGGKNFTCNNKLIGARDYTS
EGTRDLQGHGTHTTSTAAGNAVADTSFFGIGNGTARGGVPASRVAAYKVCTITGCSDDNV
LSAFDDAIADGVDLISVSLGGDYPSLYAEDTIAIGAFHAMAKGILTVHSAGNAGPNPTTV
VSVAPWMLTVAATTTNRRFLTKVVLGNGKTLVGKSVNAFDLKGKKYPLEYGDYLNESLVK
GKILVSRYLSGSEVAVSFITTDNKDYASISSRPLSVLSQDDFDSLVSYINSTRSPQGSVL
KTEAIFNQLSPKVASFSSRGPNTIAVDILKPDISAPGVEILAAYSPLSLPSEDRRDKRRV
KYSVLSGTSMACPHVTGVAAYIKTFHPDWSPSVIQSAIMTTAWQMNATGTGAESTEFAYG
AGHVDPIAAINPGLVYELNKTDHISFLCGMNYTSKTLKLISGDAVICSGKTLQRNLNYPS
MSAKLSESNSSFTVTFKRTVTNLGTANSTYKSKIVLNHGSKLNVKVSPSVLSMKSLKEKQ
SFTVTVSGSNIDPKLPSSANLIWSDGTHNVRSPIVVYIDGY

www.000webhost.com

Other information
Ka divergence:-0.0353711KaKs divergence:-0.0999785
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):2112Length 2 (bp):2106Length divergence:-0.001
MFE 1 (kcal):-626.13MFE 2 (kcal):-613.89MFE divergence-0.01