Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G59880-AT5G59890
Species:Arabidopsis
Duplication type:TD
Function (paralog1):actin depolymerizing factor 3
Function (paralog2):actin depolymerizing factor 4

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.6642545629333
Log2 mRNA fold difference:-1.3913972393982
Log2 TE fold difference:-0.2701883230966
Sequences
Protein sequence

MANAASGMAVHDDCKLKFMELKTKRTHRFIIYKIEELQKQVIVEKIGEPGQTHEDLAASL
PADECRYAIFDFDFVSSEGVPRSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVE
LQATDPTEMDLDVFKSRAN

MANAASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASL
PADECRYAIYDFDFVTAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVE
LQATDPTEMDLDVLKSRVN

www.000webhost.com

Other information
Ka divergence:-0.287632KaKs divergence:0.0128866
GC content 1 (%):46GC content 2 (%):44GC content divergence:-0.022
Length 1 (bp):420Length 2 (bp):420Length divergence:0
MFE 1 (kcal):-132.2MFE 2 (kcal):-124.31MFE divergence-0.031