Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT5G62690-AT5G62700
Species:Arabidopsis
Duplication type:TD
Function (paralog1):tubulin beta chain 2
Function (paralog2):tubulin beta chain 3

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.19858078697291
Log2 mRNA fold difference:0.10317847313474
Log2 TE fold difference:0.093225909381319
Sequences
Protein sequence

MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV
PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQMWDSKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEGDYEDEEEGEYQQEEEY

MREILHIQGGQCGNQIGAKFWEVVCAEHGIDPTGRYTGDSDLQLERINVYYNEASCGRFV
PRAVLMDLEPGTMDSLRSGPYGQTFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRSLTVPELTQQMWDSKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMLNVQNKNSSYFVEWIPNNVKSTVCDIPPTG
LKMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEEGDYEDEEEGEYQQEEEY

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0.99985
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):1353Length 2 (bp):1353Length divergence:0
MFE 1 (kcal):-454.87MFE 2 (kcal):-462.07MFE divergence0.008