Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000236-GRMZM2G106303
Species:maize
Duplication type:TD
Function (paralog1):12-oxo-phytodienoic acid reductase2
Function (paralog2):12-oxo-phytodienoic acid reductase1

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.11896043229837
Log2 mRNA fold difference:0.095625659795284
Log2 TE fold difference:-0.195764520142
Sequences
Protein sequence

MVQQAAKEVIPLLTPYKMGQFELSHRVVLAPLTRCRSYGNVPQPHAAVYYSQRATRGGLL
IAEATGVSATAQGFPESPGIWTQEQVEAWKPIVDAVHRKGAIFVCQIWHVGRVSTNELQP
NGDAPISSTDKQISPDAKSGTAYSKPRRLRTDEVPGIVDDFRRAARNAIQAGFDAVEIHG
AHGYLLEQFMKDSCNDRTDQYGGSLENRCRLAVEVVDAVVREVGARRVGIRLSPFVDFVD
CVDSDPVALGHYMVQQLNRHSGLLYCHMVEPRITAHGRRQIPHGLLPFRKAFHGTFIAAG
GYDREEGNKVVAEGYADLVAYGKLFLANPDLPRRFELDVALNKYDRSTFYTQDPIVGYTD
YPFFEEEDGKNER*

MVQQAAKEVIPLLTPYKMGQFELSHRVVLAPLTRCRSYGNVPQPHAAVYYSQRATRGGLL
IAEATGVSATAQGYPETPGIWTQEQVEAWKPIVDAVRRKGAIFVCQIWHVGRVSTNELQP
NGDAPISSTDKQISPDAESGTAYSKPRRLRTDEVSGIVDDFRRAARNAIQAGFDAVEIHG
AHGYLLEQFMKDSCNDRTDQYGGSLENRCRLAVEVVDAVVREVGARRVGIRLSPFVDFVD
CVDSDPVALGHYMVQQLNRHSGLLYCHMVEPRMATVDGRRQIPHGLLPFRKAFHGTFIAA
GGYDREDGNKVVAEGYADLVAYGRLFLANPDLPRRFELDVALNKYDRSTFYTQDPIVGYT
DYPFFEEEDGKNEESV*

Other information
Ka divergence:-0.30792KaKs divergence:-0.268477
GC content 1 (%):64GC content 2 (%):64GC content divergence:0
Length 1 (bp):1122Length 2 (bp):1131Length divergence:0.004
MFE 1 (kcal):-511.6MFE 2 (kcal):-518.82MFE divergence0.007