Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000278-GRMZM2G130018
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC542190
Function (paralog2):hypothetical protein LOC100216941

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.1116592310272
Log2 mRNA fold difference:-1.0054784994103
Log2 TE fold difference:-1.1078958591095
Sequences
Protein sequence

MEKYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHHNI
IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMRCA
TANFVWIHSQQICHRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYIA
PEVLSRREYDGKMADVWSCGVTLYVMLVGAYPFEDPDDPKNFRKTIGRIVSIQYQIPEYV
HISQDCRQLLARIFVANPAKRITIREIRNHPWFLKNLPRELTEAAQAKYYKKDNSAPTFS
DQTVEEIMKIVEEARTPPQSSTPVAGFGWAEEEEQEDGKRSDDDEQYGEDEDYDGEDEYD
KQVKHVHASGDFQHLLK*

MERYELLKDIGSGNFGVARLMRNKDTKELVAMKYIPRGLKIDENVAREIINHRSLRHPNI
IRFKEVVLTPTHLAIVMEYAAGGELFDRICSAGRFSEDEARYFFQQLICGVSYCHFMQIC
HRDLKLENTLLDGSPAPRLKICDFGYSKSSLLHSKPKSTVGTPAYIAPEVLSRREYDGKM
ADVWSCGVTLYVMLVGAYPFEDPDDPKNFRKTIGRIVSIQYQIPEYVHISQDCRQLLARI
FVANPAKRITIREIRNHPWFLKNLPRELTEAAQAKYYKKDNGAPTFSDQTVEEIMKIVEE
ARTPPQSPAPVAGFGWAEEEEQEDGKKPEDDEQDGEDEQYDGEDEYDKQVKQVHASGDFR
HLIK*

Other information
Ka divergence:-0.290572KaKs divergence:-0.313453
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):1134Length 2 (bp):1095Length divergence:-0.017
MFE 1 (kcal):-408.25MFE 2 (kcal):-379MFE divergence-0.037