Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000280-GRMZM2G020775
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192732
Function (paralog2):hypothetical protein LOC100193791

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.9122422458298
Log2 mRNA fold difference:2.3263750092874
Log2 TE fold difference:1.5946583222062
Sequences
Protein sequence

MASPTAGDAPLASPSPSPAADATDAALAAAAAVPDPDISFGFLRPELGKEKLVGTVGFHE
RHVFLCYKGPEVWPSHVEAAHSDRLPRLLAAAIKARKPNLKKTIKFTICEGEDGTESSNG
DVLIFPDMIRYKGLTHFDVDNFVEEVFVKDIDWLPGSPEPISGSYVFVCSHQRRDIRCGI
CGPALIKRFKEEINGLGLDGQVAVSACSHVGGHKYAGNVIIFSSDAKGEVVGHWYGYVVP
DDVPVLLHKHIGQGEVVDRLWRGQMGLSEEQQKQALELRSMTNGGKESLEETETDGASCN
PAATGGCCQGNGGFTRALEQQKQALELRSMTNGGKESLEETETDGASCNPAATGGCCQGN
GSFTCCHPDLPKEKRDKSIAIEQNPKSCEENGKEGGGAGSKKGNSKTCPMPTWFETWERA
DTYAALAVVAAAAAVFISFRIYKNLN*

MLHIFPKLLKQFPFPPRPLSSSQRVPTRRRLLPLRLLMASPTQGDAPLAAPAPAADATDA
AFAAAAAVPDPGAEFGFQRPELGKEKLVGTVGFHERHVFLCYKGPDLWPSHLEASESDRL
PRLLAAAIKARKPNLKKTIKLTICEGEDGTESSNGDVLIFPDMIRYKGLTHFDVDNFVEE
VLVKDIDWLPRSPEPMSGSYIFVCSHGSRDKRCGVCGPALIKRFKEEINELGLDDQVAVS
ACSHVGGHKYAGNVIIFSSDAKGEVTGHWYGYVVPDDVPVLLHKHIGQGEVVDHLWRGQM
GLSVEQQKRALELRNMVNGGEESLEETRTDGASFNPAAAGGCCQGNGGFTCCQTDLPKEK
QDKSIIAEQNPKSSDKEGGAGSKKGDTKTCPVPIWFETWERADTYAALAVVAAAAAVLVS
FRIYKNLN*

Other information
Ka divergence:-0.173086KaKs divergence:0.102229
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1341Length 2 (bp):1287Length divergence:-0.021
MFE 1 (kcal):-500.8MFE 2 (kcal):-463.4MFE divergence-0.039