Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000615-GRMZM2G132991
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279781
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.39098277489883
Log2 mRNA fold difference:0.1437003165646
Log2 TE fold difference:-0.48905526668629
Sequences
Protein sequence

MPAAAVPGGGGAADAEELFRTKRIPEIRAAEGATRREISAKEEELRQLVGRSYRDLLDSA
DSILLIKQSSDVISDNLARISGSLSSLSPPHEPSPAVSAASPSPSAGGRARLYSLAARAK
YLVDTPEHIWGRLDEGLLLEAAGRYLRAQVVHGRLSRDATAAARFPLLAHQAQLVEAFRP
QISQRARERLADRRLPVAAHADALAAVAAIDSPSLAPAQALLLFLTSRRAWISQALAGLA
SDLSSYTSVLCDIARIVRITLGHVGQLFVPALSDMPLFFKTVLEKTPPEQLFGGIPDPDD
EARLWKEHMNQLEATMVLLEADAIAGACTDWLKECCTKIFGVIAGEQKLVDAIGSGELLG
SVQRLVREALDGRDGLEGSLEQWLKSVFGSDIESPWDQIHGLILKDGKDIFEDWMEEAFV
RRMKDIVHSELDRLGASVNVKELVHAIGANADPKDAGDFLAYLRKSSKGGGFWFSESKIK
KGGVLAHLKPIADENDFHSCLTLYFGPEVSRIRSAIDSKCKNILDDLLSFVESHNSAPRL
KELVPYLQEKCYRTISGVLKELEAELRKLSALLGTKKEGNDIPAASIIAERSLFIGRILF
ALRYYSSHVPLILGSPREWVKEAGGAAFARLSSPTPRHSRASFDSLVPFTSRRRTFDSPK
SPGRQFSDSPRRQTIAAAVSLFGADDRSNPRLDELNKTMQSLCIMAHNVWITWVSTELSH
ILSYDISKDDSLSSSTPLRGWEVTVIKQDETTEGPLEMQIALPSMPSLYIISFLYQACLE
IHKVGGHILYRIILHNFAWELLQKVVNIYEKFLSCVESGNSTVSEKGILQILLDLRFVGD
VLSGGKSSSTNSPEMQTKQDFLPSAVTKTSFRRKQSQLQADSAVIEPINKLVNRLSQRLD
PIDWATYEPYLWENEKQSYKRYVVLFGFLVQLNHKYTSTVQKLPTKSNTDSNIMRCSQVP
RFKYLPISAPVISSRSHKSSLQSPSSDSTSKNTWKSYSNGDGSSTPDFDDNASLVGAAPL
LKSFVTQVGSKFGENTSRWGSMLSDGQVGKLSDILPGPAAGFFSSFTSGARYDS*

MPAVPVPGGGGSSDAEELFRTKRIPEIRAVEGATRREISAKEEELRQLVGRSYRDLLDSA
DSILLIKQSSDAIFYNLARISDSLSSLSPPPEPSLAVSAVSPSPSAGGRARLYALAARAK
YLVDTPEHIWGRLDEGLLLEAAGRYLRAQVVYGRLSRDAAAAARFPLLAHQAQLVEAFRP
QIAQRARERLADRRLPVAAHADALAAVAAIDAPSLAPAPALLLFLTSRRAWISQDLAGLA
SDLSSYTSVLCDIARIVRITLGHVGQLFVPALSDMPLFFKTVTEKTPPEQLFGGIPDPDD
EARLWKEHMNQLEAIMVLLKPDVVAAACTDWLKECCSEIFGVIAGEQKLVDAIGSGELLG
SVQRLVRDALDGRDGLERSLEQWLKSVFGSDTESPWDQIRGLILKDDKDIFEDWMEEAFV
RRMKDIVHSEFDILGSSVNVKESIHAIGANADPKDAGDFLAYLRKSSKGGGFWFSESKIK
KGGVLAHLKPIADENDFRSCLTSYFGPEVSRIRSAIDSKCKNILEDLLSFVESHNSTTRL
KELVPYLQEKCYKTISGVLKELEAELRKLSALLGTKKEGNDIPAASIIAERSLFIGRLLF
ALRYHSSHVPLILGSPREWVKEVGGAAFARLSSPTARHLRASFTPRRHTFDSPKSPGRQF
SDSPRRQTIAAAVSLFGANDRSNPRLDELNKTLQSLCIMAHNVWIAWVSTELSHILSYDL
NKDDSLSSATPLRGWEVTVIKQEETTEGPLEMQIALPSMPSLYIISFLYQACLEIHKVGG
HILDRIILHNFAWELLQKVINIYENFLSSVESGNSPVSEKGILQILLDLRFIGDVLSGGT
SSSTNTTEMQTKQDSLPSTISKTSFRRKQSQLHADSAVIEPINKLVNRLSQILDPIDWAT
YEPYLWENEKQSYKRHVVLFGFLVQLNHMYTGTMQKLPTKSNTDSNIMRCSQVPRFKYLP
ISAPAISSRSHKPSLQSLSSESTSKNPWKSYSNGDRSTTPEFDDNASLVGAAPLLKSFVT
QVGTKFGENTSRWGSMLSDGQVGKLSDILPGPAAGFFSSFTSGARYDS*

Other information
Ka divergence:0.0462574KaKs divergence:0.140761
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):3225Length 2 (bp):3207Length divergence:-0.003
MFE 1 (kcal):-1160.22MFE 2 (kcal):-1132.59MFE divergence-0.012