Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000620-GRMZM2G000633
Species:maize
Duplication type:TD
Function (paralog1):receptor-like kinase
Function (paralog2):hypothetical protein LOC100273902

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.9028236956921
Log2 mRNA fold difference:-0.77621924626837
Log2 TE fold difference:-2.1346530691566
Sequences
Protein sequence

MAVLNLLALIIATLLLLFRRTSGAGISPADTLNSGGNVTDGETLVSAGGTFTLGFFSPST
TVLTKRYLGIWFTASGTDAVLWVANRETPLNNTSGVLVMSSRVGLRLLDGSGRTAWSSNT
TGASTSSVAQLLGSGNLVVREKSSNAVFQWQSFDHPQNTLLAGMRFGKNLKTGMEWSLTS
WRAQDDPATGDYRRVMDTKGLPDIVTWHGNAKKYRAGPWNGRWFSGVPEMDSGYKLFSVQ
MVDGPDEVTYVLNTTAGIPFTRVVLDEVGKVRVLMWLPTSRVWKEYPWLPRDACDEYTSC
GAFGLCNVDAAPTPSCSCAVGFSPVNASEWSRREASGGCQRDVPLECAAGNGTAVTDRFA
PVHGVKLPDTDNATVDMGATLEQCKARCLANCSCVAYAPADIRGGGDGSGCVMWKDNIVD
VRYIENGQDLFLRLAKSESATGERVRLAKILVPVMAFVLALTAAGMYLAWNCKLRAKRRN
RDNLRKAILGYSTAPNELGDENVELPFVSLGEIAAATNNFSEDNMLGQGGFGKVYKGTLG
QNVQVAIKRLGQCSGQGVEEFRNEAVLIAKLQHRNLVRLLGCCIDGDEKLLVYEYLPNRS
LDSIIFDAASKHLLDWPTRFKIIRGVCRGLLYLHQDSRLTIIHRDLKTSNILLDADMSPK
ISDFGMARIFGGNQHEANTNRVVGTYGYMSPEYAMDGVFSVKSDTYSFGVIVLEIISGLK
ISLTHCNGFPNLLAYAWSLWIDDRAMDLVDSSLEKSSSCSEALRCIQIGLLCVQDNPNSR
PLMSSVVTMLENENV*

MSLLVTFQIVISRQQQVWLVKALIDQMSTVATTCFGFRNLVHLQLYPLLQNAKQSSMHPK
VLLVASTGTTSICLLLTWNQKKRNFQKILLSAIACLLLLTIGALGWACKIRGKWHKKKIQ
TRMMLEYLSSTDEAGGKNIEFPFITFENIVTATDNFSDCNILGKGGFGKVYKGMLEGTKE
VAIKRLSKSSGQGAEEFRNEVILIAKLQHKNLVKLLGCCVHEDEKLLVYEYLPNKSLDYF
LFDSARKSTLQWPTRFKIIHGVARGIMYLHQDSRLTIIHRDLKASNILLDKDMSPKISDF
GMARIFSSDQLHANTNRVVGTYGYMSPEYAMEGAFSVKSDTYSFGVLMLEIVSGLKISSP
HLHMDFPNLRAYAWNMWKEGKIEDLVDSSVMENCSLDEVSQCVHIGLLCVQDSPSFRPLM
SAVVSMLENKTTTLPTPSQPVYFAVRDPYQPGKAVGNKELSIYDMSLTVPEGR*

Other information
Ka divergence:-0.0135963KaKs divergence:0.168043
GC content 1 (%):59GC content 2 (%):41GC content divergence:-0.18
Length 1 (bp):2388Length 2 (bp):1422Length divergence:-0.254
MFE 1 (kcal):-1014.41MFE 2 (kcal):-409.49MFE divergence-0.425