Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000632-GRMZM5G830983
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304323
Function (paralog2):hypothetical protein LOC100383292

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.3464186384155
Log2 mRNA fold difference:-0.78355398389262
Log2 TE fold difference:1.1666573170958
Sequences
Protein sequence

MIPLNRRTSLPRAGMDYFDARRKPHNVGKIIAALVLTTLCIFVLKQSPGFGGNSVFSRHE
HGVTHVLVTGGAGYIGSHAALRLLKDNYRVTIVDNLSRGNMGAVKVLQGLFPQPGRLQFI
FADLGNQKSVNKIFAENAFDAVMHFAAVAYVGESTLEPLRYYHNITSNTLLILEAMASHG
VQTLIYSSTCATYGEPDKMPITEATPQFPINPYGKAKKMAEDIIIDFSNSKGADMAVMIL
RLEPFLQLHRYFNVIGSDPEGRLGEAPRPELREHGRISGACFDAALGVIPGLKVKGTDYP
TADGTCIRDYIDVTDLVDAHVKALNKAEPRKVGIYNVGTGRGRSVNEFVDACKKATGVNI
KIEYLNRRPGDYAEVYSDPTKINKELNWTAHYTDLKESLSVAWRWQKSHPRGYGPN*

MNLIVLRFPTPKLTVVCVFLQFSRHEPGVTHVLVTGGAGYIGSHAALRLLQDSYRVTIVD
NLSRGNMGAVKVLQGLFPQPGRLQFIFADLGDQKSVNKIFAENAFDAVMHFAAVAYVGES
TLEPLRYYHNITSNTLLILEAMASHGVKTLIYSSTCATYGEPEKMPITEATPQFPINPYG
KAKKMAEDIILDFSKSKGADMAVMILRYFNVIGSDPEGRLGEAPRPELREHGRISGACFD
AALGVITGLKVKGTDYPTTDGTCIRDYIDVTDLVDAHVKALNKAEPRKVSIYNVGTGRGR
SVNEFVDACKKATGVNIKIEYLSRRPGDYAEVYSDPTKINKELNWTARYTDLKESLSVAW
RWQKSHPSGYGPNRI*

Other information
Ka divergence:0.421728KaKs divergence:0.0662366
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):1251Length 2 (bp):1128Length divergence:-0.052
MFE 1 (kcal):-398.5MFE 2 (kcal):-341.05MFE divergence-0.078