Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000741-GRMZM2G169363
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384216
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.30191629139989
Log2 mRNA fold difference:-0.039474310305665
Log2 TE fold difference:-0.2788505921832
Sequences
Protein sequence

MSFGAVDMEEESGAAAAAAAVEEIRRLPAEVNWEMLDKSRFFVLGAALFSGVSAALYPAV
VVKTHLQVAPPPQAATATAAAILRRDGLRGFYRGFGASLAGTVPARALYMAALEATKSSV
GSAAVRLGVSEPAASAAASAAAGVSAAVAAQVVWTPVDVISQRLMVQTPDACRYRGGADA
FRKILLADGVRGLYRGFGLSILTYAPSNAVWWSTYAVAQRCLWRAVGTERSESCACLMAV
QGASAALAGGTAALVTMPLDTVKTRLQVMEADAAARPTLASTVRGLLKEGGWAACYRGLG
PRWGSMSLSAATMVTTYEFLKRLSAKEGSLG*

MSFGTVGMEEESGAAAAAAAAEEIRRLPAEVNWEMLDKSRFFVLGAALFSGVSAALYPAV
VVKTHLQVAPPPQAARATAAAILRRDGLRGFYRGFGASLGGTVPARALYMAALEATKSSV
GPAAVRLGVSEPAASAAASAAAGVSAAVAAQVVWTPVDVISQRLMVQTPACCRYRGGVDA
CRKILLADGVRGLYRGFGLSILTYAPSNAVWWSTYAVAQRCLWRAVGPERSESCASLMAV
QGASAAVAGGAAALVTMPLDTVKTRLQVMEADAARPTLASTVRGLLREGGWAACYRGLVP
RWGSMSLSAATMVTTYEFLKRLSAKDGSLG*

www.000webhost.com

Other information
Ka divergence:0.193863KaKs divergence:0.253121
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):996Length 2 (bp):993Length divergence:-0.002
MFE 1 (kcal):-604.3MFE 2 (kcal):-610.2MFE divergence0.005