Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G000923-GRMZM2G465333
Species:maize
Duplication type:WGD
Function (paralog1):nascent polypeptide-associated complex alpha subunit-like protein
Function (paralog2):nascent polypeptide-associated complex alpha subunit-like protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.55868953740513
Log2 mRNA fold difference:-0.72565666563064
Log2 TE fold difference:0.17118879486432
Sequences
Protein sequence

MTAQTAEELATQIEQQKLEEQKTEAEEVVVEDEEEEDEDDDDDDKDDDELDEGDASGKSK
QSRSEKKSRKAMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPNSDTYVIFGEAKI
EDLSSQLQTQAAEQFKAPDLSQMILNPETSGPGQEDNDEEVDETGVEAKDIELVMTQASV
SRPKAVKALKASNGDIVTAIMDLTT*

MTAQTAEELATQIEQQKLEEQKTEAEEVVVEDEEDDDDEDDEDDDELDGQEGDASGKSKQ
SRSEKKSRKAMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPNSDTYVIFGEAKIE
DLSSQLQTQAAEQFKAPDLSQITSPETSGPGQEDNDEEVDETGVEAKDIELVMTQASVSR
PKAVRALKASNGDIVTAIMDLTT*

Other information
Ka divergence:0.245962KaKs divergence:0.299137
GC content 1 (%):53GC content 2 (%):55GC content divergence:0.019
Length 1 (bp):618Length 2 (bp):612Length divergence:-0.005
MFE 1 (kcal):-216.5MFE 2 (kcal):-198.4MFE divergence-0.044