Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001033-GRMZM2G172647
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100191402

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.7088044585407
Log2 mRNA fold difference:-0.11815578272016
Log2 TE fold difference:-0.58690138301145
Sequences
Protein sequence

MQRNGVVECSVCHSRVVVPSPRSVSRAYDKHRSKMSSKFRALNVFLVVGDCILVGLQPIL
VFMSKVDGKFQFSPISVNFLTEVMKVIFAIVMLIIQSRKQKVGEKPLLARSTFIQAARNN
VLLAVPALLYAINNYLKFIMQLYFNPATVKMLSNLKVLVIAVLLKFIMRRRFSVIQWEAL
ALLLIGISINQLRTVPAGNTAFGLPVTAIAYIYTLIFVTVPSMASVYNEYALKSQYDTSI
YLQNLFLYGYGAIFNFLGILTNVILQGQRVLIFFEDIRGPRCFSYVIMQHKAFYLHSSSS
MQTQF*

MQRNGVVECSVCRSRVVVPSPRSVSRAYDKHRNKMSSKFRALNVFLVVGDCILVGLQPIL
VFMSKVDGKFQFSPISVNFLTEVMKVIFAVVMLIIQSRKQKVGEKPLLARSTFIQAARNN
VLLAVPALLYAINNYLKFIMQLYFNPATVKMLSNLKVLVIAFLLKFIMRRRFSVIQWEAL
ALLLIGISINQLRTVPVGNTAFGLPVTAIAYIYTLIFVTVPSVASVYNEYALKSQYDTSI
YLQNLFLYGYGAIFNLLGILGTVLFQGPESFNILRGHSRATIFLICNNAAQGILSSFFFK
YADTILKKYSSTVATIFTGLASAAFLGHSLTINFLLGISVVFISMHQFFSPLAKVKDDKP
ADSIELEDTQNDRPSESSFVNMTAGAADDASHRIGTDERQPLLPI*

Other information
Ka divergence:-0.659113KaKs divergence:-0.227042
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):918Length 2 (bp):1218Length divergence:0.14
MFE 1 (kcal):-266.05MFE 2 (kcal):-354.34MFE divergence0.142