Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001079-GRMZM2G118959
Species:maize
Duplication type:WGD
Function (paralog1):beta3-glucuronyltransferase
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.56232026333612
Log2 mRNA fold difference:-0.77557773017405
Log2 TE fold difference:0.21432623249148
Sequences
Protein sequence

MGSSTDHAAGARGKKQGSQLWKKALLHSSLCFVMGFFTGFAPSSVSDWTSAAAAAGGRVG
SSHVVRALPAGGAGAVNRSLLAHDAGGGGLPRDPASPRPLLVVVTTTESTPAATGERAAA
LTRAAHALRLVAPPLLWVVVEAAPDAPATARLLRATGLMYRHLTYKDNFTSADAAAGRER
HHQRNVALGHIEHHRLAGVVLFAGLGDVFDLRFFDELRGISAFGAWPVATMRRGERKVVV
RGPACSSAAVTGWFSQDLGGSGTAAASASTARPGELDVHGFAFNSSVLWDPERWGRYPTS
EPDKSQDSMKFVQQVVLEDFSKVKGIPSDCSEVMVWHVDTAAPSLQNKKRR*

MGSSTDHGGAGWRGKKQGSQLWKKALLHSSLCFVMGFFTGFAPSSVSDWTSAAAAAGSSS
SSSHVVRALPAGGALNRSLLAHGAGPGYDRAASPRPLLVVVTTTESTPVASGERAAALTR
TAHALRLVAPPLLWVVVEAAPDAPATARQLRATGLMYRHLTYRDNFTAAGAGKERHHQRN
VALGHVEHHRLAGVVLFAGLDDVLDLRLFDQIREISAFGAWPVATMWRDEREVVVRGPAC
SSSAVTGWFSQDLSDGTAAAASTTSTARARPSGEVDVHGFAFNSSVLWDPERWGRYPTSE
PDKSQDSTKFVQQVVLEDLSKVKGIPSDCSEVMVWHVDTAAPSPSSPQNKRR*

Other information
Ka divergence:0.113225KaKs divergence:0.186843
GC content 1 (%):72GC content 2 (%):71GC content divergence:-0.007
Length 1 (bp):1056Length 2 (bp):1059Length divergence:0.001
MFE 1 (kcal):-584.4MFE 2 (kcal):-567MFE divergence-0.015