Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001288-GRMZM2G012140
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:4.3758458395938
Log2 mRNA fold difference:2.9174276630912
Log2 TE fold difference:1.3764970918037
Sequences
Protein sequence

MMSSQKRRKGCIFFSLALLLCSASGGVPSLASENSPSEFAKIVQSKQTRHARVCGADPQL
LSSLAGSGAEVMLTVPNEQLEHVAEFQEEADLWVAASVARFVPATRITHVLAGDDAPARS
PPSAHFLVPAMANLRSALAAAGLAGRVSVSSALSAETLAAPDPDWSGVVGRVLRSLASAG
SPLVLKSSGPSEASDARADAAYAAMRALGVSGVPVIAADLAAAAADVVPYYYYGYGYADG
HSHPGVQRRSLATGTFCVALQNADPAALQAGLSWACGPGHADCSAIQPGGACYQQNNLPA
LASYAYNDYYQRMASTGATCSFNGTATTTTNDPSSGSCVFAGSSNSSVPVGASPPTSLSP
PTGFTPPVGSSPPSSSEFGPPAAGTTPPAGGGLGPGFGTPPGSFNGTGSFGPSGTLNPYN
GVSRGLPRAGLFTALSAAAVAVLLVSVDAM*

MLQKRWKGCIFFLLLSGALGVLMASESSSSEFAKIVQSKQTRQARLCGADSELLSSLAGS
DAEVMVTIPNEQLEHVAEFQEEADLWVAANVARFLPSTRITHVVAGDDVPANSPGSAHFL
VPAMLNLRSALVAAGLGGRVKVSSAMSGEALSAPAWSGVVGHVLRFLESAGSPLLLKSSS
RPSEEASDARVGRAYAAMRALGVSGVPVIATDLAAGGDAVPYYYSYYGYGYPGGHGRRRS
LATTGTFCVALQDADPAALQAGLNWACGPGHADCSAIQPGGACYQQNNLPAIASYAYNDY
YQEMASTGATCSFNGTATTTTNDPSSGSCVFAGSSTAGGSSNSSVPVGASPPTSLSPPTG
FAPPVGSSPPSSSSEFSPPAVGTAPLSGFTPPDGGGFGTPPGSFNGTGTFGPSGTLSPYN
GGAPGLSRAGLSLTALSAAAVAVLLASIDAM*

Other information
Ka divergence:-0.0887301KaKs divergence:-0.0316535
GC content 1 (%):71GC content 2 (%):69GC content divergence:-0.014
Length 1 (bp):1353Length 2 (bp):1356Length divergence:0.001
MFE 1 (kcal):-685.14MFE 2 (kcal):-706.5MFE divergence0.015