Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001289-GRMZM2G122897
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100279217
Function (paralog2):hypothetical protein LOC100383453

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.011820759094283
Log2 mRNA fold difference:-0.41718163220729
Log2 TE fold difference:0.44504727533274
Sequences
Protein sequence

MMIPARHMPPTMIVRNGGAAYGSSSALSLGQPNLMDNQQLQFQQALQQQHLLLDQIPATT
AESCDNTGRGGGGRGSDPLADEFESKSGSENVDGVSVDDQDDPNQRPSKKKRYHRHTLHQ
IQEMEAFFKECPHPDDKQRKELSRELGLVPLQVKFWFQNKRTQMKNQHERQENSQLRAEN
EKLRAENMRYKEALSSASCPNCGGPAALGEMSFDEHHLRVENARLREEIDRISAIAAKYV
GKPMVSFPVLSSPLAGARPSPLDIDSGGVLGGAATYGGAADIFGGGGGVAACGAARDCDK
PMIVELAVTAMEELVRMAQLDEPLWNAPAGGHDGSAETLNEEEYARMFVPAGGLGLKKQY
GFKSEASRDSSVVIMTHASLVEILMDVNQYATVFSSIVSRAATLEVLSTGVAGNYNGALQ
VMSVEFQVPSPLVPTRDSYFVRYCKQNADGTWAVVDVSLDTSSVLKCRRRPSGCLIQEMP
NGYSKVTWVEHVEVDDRSVNGIYKLLVDSGLAFGARRWVGTLDRQCERLASVMASNIPTS
DIGVITSTEGRKSMLKLAERMVTSFCGGVTASAAHQWTTLSGSGADDVRVMTRKSVDDPG
RPPGIVLNAATSFWLPITPKRVFDFLRDESSRSEARTRAPTHTQFFFNREHVLPSYEPPF
LFFFFLFLQWDILSNGGVVQEMAHIANGRDHGNCVSLLRVNQSTNSTQSNMLILQESCTD
ASGSYVIYAPVDVVAMNVVLNGGDPDYVALLPSGFAILPDGPSGSSNMQGGGGGGVGSGG
SLLTVAFQILVDSVPTAKLSLGSVATVNSLIARTVERIKAAVSGESVTQQ*

MGRGGGGVSDPLLGDEFESKSGSENVDGGVSVDELQDPNQRPSKKKRYHRHTQHQIQELE
AFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKNHHERQENSQLRSENEKLRA
ENMRYKEALSSASCPSCGGPAALGEMSFDEHHLRVENARLREEVDRISSIAAKYVGRPMV
PFPVLSSPLAGAGARAPALPPLDMAPPYGAAADMFGGGGVVAAAGAAGAGDLLLRGAAVQ
SDADKPMIVELAVAAMEELVRMAQLDEPLWNAPAGLDGSAEEETLNEEEYARLFPGGLGP
KPYGLNSEASRDSAVVIMTHANLVEILMDVNQYAAVFSSIVSRAATLEVLSTGVAGNYNG
ALQVMSVEFQVPSPLVPTRESYFVRYCKQNADGTWAVVDVSLDGLRPGAVLKCRRRPSGC
LIQEMPNGYSKVTWVEHVEVDDRSVHSIYKLLVSSGLAFGARRWVGTLDRQCERLASVMA
SNIPTSDIGVITSAEGRKSMLKLAERMVMSFCGGVTASAAHQWTTLSGSGAEDVRVMTRK
SVDDPGRPPGIVLNAATSFWLPVPPKRVFDFLRDESSRSEWDILSNGGVVQEMAHIANGR
DHGNCVSLLRVNSTNSNQSSMLILQESCTDMSGSYVIYAPVDVVAMNVVLNGGDPDYVAL
LPSGFAILPDGPSSGSSSMLQGDGGVGSGGSLLTVAFQILVDSVPTAKISLGSVATVNSL
IACTVERIKAAVISGQSNPQQQ*

Other information
Ka divergence:-0.0110949KaKs divergence:-0.0713664
GC content 1 (%):63GC content 2 (%):66GC content divergence:0.023
Length 1 (bp):2493Length 2 (bp):2229Length divergence:-0.056
MFE 1 (kcal):-1121.21MFE 2 (kcal):-1075.5MFE divergence-0.021