Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001451-GRMZM2G063223
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274211
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.3937590452854
Log2 mRNA fold difference:0.043736341176091
Log2 TE fold difference:-1.4456162672895
Sequences
Protein sequence

MASPSTEAPLPHPTIRDVMGHDDDDDYYGDHTIAEEEEGDEEEEEWDMSKRMSRLSLEGS
DGGDADDEAGVDEEEDDEFEVPERSDVNAATAYRAWPPYEDPQQAPSSASLPGTPDRGAQ
AAGWPGASAKEYASETEARWPPGADGRGGRRQRQHQRRWQRMGREAWLERAWRMRKQRRQ
LQEEVVPVVVLGGGGDSPASRGGVAMDMEEVRACRDLGLDLPCDWTVEIPSYYALSGVDT
ASSGGNSPASAGSWRISSPGDDPKDVKARLKVWAQVVALASASRLGS*

MASPSTEAPPLPTLRDVIAHDDDDDHFIAEEEEDEEWDDMSKRMSRLSMEGSEAGDADDE
DDGGEDEGEEDDDEFDDVRSDVNAAATYRAWPPRDEPQQAPSAASLPGTPDRGAQAPWWP
GPSAKGYASETEARWPPGADGRGGRRQRQRMAAREVWLERAWRTRKQRRQLQEEVPVPVV
VLGGGGGDSPASRGVAMDMEEVRACRDLGLDLPCDWTVEIPSCALSVSGVDTASSGGNSP
ASGSWRISSPGDDPKDVKARLKVWAQAVALASASRLGS*

www.000webhost.com

Other information
Ka divergence:0.260721KaKs divergence:0.487731
GC content 1 (%):73GC content 2 (%):73GC content divergence:0
Length 1 (bp):864Length 2 (bp):837Length divergence:-0.016
MFE 1 (kcal):-460MFE 2 (kcal):-459.4MFE divergence-0.001