Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G001592-GRMZM2G001606
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100277670
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.0005248121436
Log2 mRNA fold difference:-1.0305556104896
Log2 TE fold difference:0.064490548865016
Sequences
Protein sequence

MRIRKSASRLLGSAYSASAAPTVDAAPRLDLLPPPHPAPCSAPESCGGSAFSSPSVSTAE
PCELSRSPWDLIADLSLSDKKVEDELVDKYFVHVTTRASWLFSSTVSATTSTKKKKKLPA
AVYEDSTQLRREAAKKTATNREEGETKKKAKVKKEEVQQDGAAAAAAQVWKCKKNDGRRW
HCNRPVSQPNTLCEYHFVQKRSYLNPGFEFHSTAELEGAAPAPAPVHAASSKLSTSNKPR
KKKKPGNDFSATEGFYYYAGFGPFRTKRQCRSGGTNEPLPAKQEEEEETPEYASHHTEEE
EKEAKVAGFTNQAASQDDVSSCDDDIAGIAGVDEESSDGDYDGIGLGGCNVDGAADPQAS
IGEVRRKAPWKRWRKPVKARSLKSLM*

MRIRKSASRLLGSAYSASAASPVDSTPPFSPLPPPPPPPPPHLAPCSAPEYCGGLGFSSP
SSSSAEPCELSRSPWDLIAELSVSDPQVEDDIVDKYFVHVATRSSWLFSATVPAASAKKK
SSSTSGDSKHKQQLRRDAVNKSATSKEKVGEANKKAKVKKEEEGQDGDRGARVWLCKKND
GKRWHCNRPVSQPNTLCEYHSVQKRSYLEAPSVAKLEEAPAPAPAAAPKSSARNKPRKKK
PGSDVSATEGFYYYAGFGPFRSTKRQCKSGGTNEPAPAKEDDEGNQAKHASPGQKAEVDE
GHHDDTTTNQTATAAYGDTSSCEDDIAGTIAGVDEGSSDDDDFDGLGISGHSMNGNGDPK
ASSGDVKTKIPWKRWRKPVKARSLKSLM*

Other information
Ka divergence:0.057205KaKs divergence:0.0858873
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):1161Length 2 (bp):1167Length divergence:0.003
MFE 1 (kcal):-450.82MFE 2 (kcal):-464.02MFE divergence0.014